DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Drd5

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_038531.1 Gene:Drd5 / 13492 MGIID:94927 Length:478 Species:Mus musculus


Alignment Length:257 Identity:96/257 - (37%)
Similarity:139/257 - (54%) Gaps:34/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 IFSSIILAAVLGNALVIISVQRNRKLRV-ITNYFVVSLAMADMLVALCAMTFNASVELSGGKWMF 208
            :.:.:|:..:|||.||..::.|:|.||. :||.|:||||::|:.|||..|.:.|..|:: |.|.|
Mouse    44 LLTLLIVWTLLGNVLVCAAIVRSRHLRAKMTNIFIVSLAVSDLFVALLVMPWKAVAEVA-GYWPF 107

  Fly   209 GPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISF 273
            |.| |:::.:.|:..||||||:||.||||||:||.||..|...||.:....|:|..|.|..||||
Mouse   108 GAF-CDIWVAFDIMCSTASILNLCIISVDRYWAISRPFRYERKMTQRVALVMVALAWTLSILISF 171

  Fly   274 TPIFLGWY----------------TTEEHLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVML 322
            .|:.|.|:                |..|...|:....:.|...:|:.||:.||.:||:||..:|:
Mouse   172 IPVQLNWHRDKAGSQGREGLLSNETPWEEGWELDGRTENCDSSLNRTYAISSSLISFYIPVAIMI 236

  Fly   323 VMYWRIFKEA---IRQRKALSRTSSNILLNSVHMGHTQQPTSLSYLHPSDCDLNATSAREET 381
            |.|.||::.|   ||:..:|.|.:.          |.|...|.....| |..|.| |.::||
Mouse   237 VTYTRIYRIAQVQIRRISSLERAAE----------HAQSCRSRGACEP-DPSLRA-SIKKET 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 86/219 (39%)
7tm_1 156..>344 CDD:278431 84/207 (41%)
Drd5NP_038531.1 7tm_1 55..354 CDD:278431 94/246 (38%)
7tm_4 <121..>173 CDD:304433 29/51 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 416..446
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.