DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Adrb2

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_031446.2 Gene:Adrb2 / 11555 MGIID:87938 Length:418 Species:Mus musculus


Alignment Length:295 Identity:100/295 - (33%)
Similarity:154/295 - (52%) Gaps:36/295 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 VGPNITANGSDIAV----------DNQAELEESW-LDLSLLLLKGFIFSSIILAAVLGNALVIIS 163
            :||:  .|.||..:          |...|.:|:| :.:::|:      |.|:||.|.||.|||.:
Mouse     1 MGPH--GNDSDFLLAPNGSRAPDHDVTQERDEAWVVGMAILM------SVIVLAIVFGNVLVITA 57

  Fly   164 VQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASI 228
            :.:..:|:.:||||::|||.||:::.|..:.|.|| .:....|.||.|.|..:.|:||...||||
Mouse    58 IAKFERLQTVTNYFIISLACADLVMGLAVVPFGAS-HILMKMWNFGNFWCEFWTSIDVLCVTASI 121

  Fly   229 LHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYTTEEHLREISLH 293
            ..||.|:||||.||..|.:|...:|......::..|||:..|.||.||.:.||.. .|.:.|..:
Mouse   122 ETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRA-THKKAIDCY 185

  Fly   294 PDQ--CSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKALSRTSSNILLNSVHMGHT 356
            .::  |.|..|:|||:.||.|||::|.:||:.:|.|:|:.|.||.:.:.::....        |.
Mouse   186 TEETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRVFQVAKRQLQKIDKSEGRF--------HA 242

  Fly   357 QQPTSLSYLHPSDCDLNATS---AREETHSALSNL 388
            |..:.:.....|...|..:|   .:|  |.||..|
Mouse   243 QNLSQVEQDGRSGHGLRRSSKFCLKE--HKALKTL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 80/201 (40%)
7tm_1 156..>344 CDD:278431 75/189 (40%)
Adrb2NP_031446.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 5/23 (22%)
7tm_4 48..340 CDD:304433 86/240 (36%)
7tm_1 50..326 CDD:278431 85/238 (36%)
PDZ-binding 415..418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 228 1.000 Domainoid score I2479
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8780
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.