DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Adrb1

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_031445.2 Gene:Adrb1 / 11554 MGIID:87937 Length:466 Species:Mus musculus


Alignment Length:259 Identity:89/259 - (34%)
Similarity:140/259 - (54%) Gaps:9/259 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 AVDNQAELEESW-LDLSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMAD 185
            |.:..|.|.:.| ..:.|||      :.|:|..|:||.|||:::.:..:|:.:||.|::|||.||
Mouse    46 ASEGSAPLSQQWTAGMGLLL------ALIVLLIVVGNVLVIVAIAKTPRLQTLTNLFIMSLASAD 104

  Fly   186 MLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPL 250
            :::.|..:.|.|:: :..|:|.:|.|.|.::.|:||...||||..||.|::|||.||..|..|..
Mouse   105 LVMGLLVVPFGATI-VVWGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQS 168

  Fly   251 NMTHKTVCFMLANVWILPALISFTPIFLGWYTTE-EHLREISLHPDQCSFVVNKAYALISSSVSF 314
            .:|......::..||.:.||:||.||.:.|:..| :..|.....|..|.||.|:|||:.||.|||
Mouse   169 LLTRARARALVCTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSF 233

  Fly   315 WIPGIVMLVMYWRIFKEAIRQRKALSRTSSNILLNSVHMGHTQQPTSLSYLHPSDCDLNATSAR 378
            ::|..:|..:|.|:|:||.:|.|.:.......|.........:...|.....|:|...|..|::
Mouse   234 YVPLCIMAFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPEPSPSPGPPRPADSLANGRSSK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 76/200 (38%)
7tm_1 156..>344 CDD:278431 73/188 (39%)
Adrb1NP_031445.2 7tmA_Beta1_AR 59..376 CDD:320624 85/246 (35%)
TM helix 1 60..86 CDD:320624 11/31 (35%)
TM helix 2 93..120 CDD:320624 11/27 (41%)
TM helix 3 131..161 CDD:320624 15/29 (52%)
TM helix 4 175..193 CDD:320624 6/17 (35%)
TM helix 5 221..253 CDD:320624 16/31 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..302 6/34 (18%)
TM helix 6 306..336 CDD:320624
TM helix 7 345..370 CDD:320624
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..466
PDZ-Binding. /evidence=ECO:0000250 463..466
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 228 1.000 Domainoid score I2479
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D328277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8780
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.