DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Taar1

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_599155.1 Gene:Taar1 / 113914 RGDID:621621 Length:332 Species:Rattus norvegicus


Alignment Length:263 Identity:80/263 - (30%)
Similarity:129/263 - (49%) Gaps:44/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 NITANGSDIAVDNQAELEESWLDLSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLRVITNYF 177
            ||:...|:.:.|.:|.|..             :.|.|||..::||.:||||:...::|...||:.
  Rat     9 NISHTNSNWSRDVRASLYS-------------LISLIILTTLVGNLIVIISISHFKQLHTPTNWL 60

  Fly   178 VVSLAMADMLVALCAMTFN--ASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYY 240
            :.|:|:.|.|:....|.::  .:||..   |.||...|.::.|.|:..|:||||||..||:||||
  Rat    61 LHSMAVVDFLLGCLVMPYSMVRTVEHC---WYFGELFCKLHTSTDIMLSSASILHLAFISIDRYY 122

  Fly   241 AIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYTTEEHLREISLHPDQ--------- 296
            |:..||.|...:....:..|:...|.|||:.:|..|||          |::|...:         
  Rat   123 AVCDPLRYKAKINLAAIFVMILISWSLPAVFAFGMIFL----------ELNLEGVEEQYHNQVFC 177

  Fly   297 ---CSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKALSRTSSNILLNSVHMGHTQQ 358
               |....:|...:::...||:|||.|||.:|:||:..|..|.::::|.:..:.|.    |.::.
  Rat   178 LRGCFPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRANLQVGLE----GESRA 238

  Fly   359 PTS 361
            |.|
  Rat   239 PQS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 70/213 (33%)
7tm_1 156..>344 CDD:278431 66/201 (33%)
Taar1NP_599155.1 7tm_4 30..>164 CDD:304433 53/146 (36%)
7tm_1 39..301 CDD:278431 70/220 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.