DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and htr4

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:XP_009289337.1 Gene:htr4 / 101882850 ZFINID:ZDB-GENE-160114-31 Length:423 Species:Danio rerio


Alignment Length:238 Identity:101/238 - (42%)
Similarity:147/238 - (61%) Gaps:12/238 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 NITANGSDIAVDNQAELEESWLDLSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLRVI-TNY 176
            |:::.|....::.....|.:.|...:.|:.  ..|.::|.:||||.||:::|.::|:||.| |||
Zfish    35 NLSSTGQMPEMEEVDTNESNGLAKRVALIS--FLSLVMLMSVLGNLLVMVAVCKDRQLRKIKTNY 97

  Fly   177 FVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYA 241
            |:||||.||:||::..|.|.| :||....|::|...|.|..||||..:|||||||||||:|||||
Zfish    98 FIVSLAFADLLVSVLVMPFGA-IELIHQNWIYGETFCLVRTSLDVLLTTASILHLCCISLDRYYA 161

  Fly   242 I-VRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYT--TEEHL--REISLHPDQCSFVV 301
            | .:||.|...||...|..|:...||:|.:|||.||..||.:  .::.:  |:||.:...|.|:|
Zfish   162 ICCQPLVYRNKMTPLRVTLMIGGCWIIPTVISFLPIMQGWNSIGIKDLIDKRKISGNSTVCVFMV 226

  Fly   302 NKAYALISSSVSFWIPGIVMLVMYWRIF---KEAIRQRKALSR 341
            ||.|||..|.|:|::|.::|::.|.||:   :|..||...|.|
Zfish   227 NKPYALTCSVVAFYLPLVLMVLAYQRIYVTAREHARQISMLQR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 96/205 (47%)
7tm_1 156..>344 CDD:278431 92/195 (47%)
htr4XP_009289337.1 7tm_4 68..>198 CDD:304433 68/130 (52%)
7tm_1 76..348 CDD:278431 92/195 (47%)
TAS2R <172..365 CDD:283059 38/98 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D328277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26202
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.