DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and htr4

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:XP_002939852.1 Gene:htr4 / 100493952 XenbaseID:XB-GENE-993770 Length:386 Species:Xenopus tropicalis


Alignment Length:285 Identity:113/285 - (39%)
Similarity:157/285 - (55%) Gaps:46/285 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 NITAN-GSDIAVDNQAELEESWLDLSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLRVI-TN 175
            |:|:| |..:|              :.::|..|| |::||..:|||.||:::|.|:|:||.| ||
 Frog     6 NVTSNEGYGVA--------------ARIVLISFI-SAVILMTILGNLLVMVAVCRDRQLRKIKTN 55

  Fly   176 YFVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYY 240
            ||:||||.||:||::..|.|.| :||...||::|...|.|..||||..:|||||||||||:||||
 Frog    56 YFIVSLAFADLLVSVLVMPFGA-IELVQEKWIYGEMFCLVRTSLDVLLTTASILHLCCISLDRYY 119

  Fly   241 AI-VRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYT------TEEHLREISLHPDQCS 298
            || .:||.|...||...:..||:..||:|..|||.||..||.:      .|......|.:...|.
 Frog   120 AICCQPLVYRNKMTPLRITLMLSGCWIIPTFISFLPIMQGWNSIGILDLIETRKYNKSSNSTNCI 184

  Fly   299 FVVNKAYALISSSVSFWIPGIVMLVMYWRIF---KEAIRQRKALSRTSSNILLNSVHMGHTQQPT 360
            |:|||.||:..|.|:|:||..:|::.|:||:   :|..||...|.|..:              |.
 Frog   185 FMVNKPYAITCSVVAFYIPFFLMVLAYYRIYITAREHARQIGVLQRAGA--------------PA 235

  Fly   361 SLSYLHPSDCDLNAT-SAREETHSA 384
            ...:.||   |.:.| ..:.||.:|
 Frog   236 DHRHQHP---DQHTTHRMKTETKAA 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 97/210 (46%)
7tm_1 156..>344 CDD:278431 93/198 (47%)
htr4XP_002939852.1 7tmA_5-HT4 19..322 CDD:320184 108/258 (42%)
TM helix 1 20..46 CDD:320184 12/26 (46%)
TM helix 2 54..80 CDD:320184 15/26 (58%)
TM helix 3 92..122 CDD:320184 22/29 (76%)
TM helix 4 135..158 CDD:320184 10/22 (45%)
TM helix 5 188..217 CDD:320184 13/28 (46%)
TM helix 6 251..281 CDD:320184 3/7 (43%)
TM helix 7 290..315 CDD:320184
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D328277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14086
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.