DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and hrh2

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:XP_002938111.2 Gene:hrh2 / 100491392 XenbaseID:XB-GENE-991059 Length:387 Species:Xenopus tropicalis


Alignment Length:212 Identity:79/212 - (37%)
Similarity:128/212 - (60%) Gaps:2/212 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 WLDLSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNA 197
            |..:...:|.|.:...||:..:.||.:|.::|..:||||.:||.|:||||:.|:|:.:..:.|:|
 Frog    17 WKSVLYNVLIGAVLVLIIIITICGNVVVCLAVGLDRKLRSMTNCFIVSLAITDLLLGILVLPFSA 81

  Fly   198 SVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLA 262
             :.|...:|.||...||:|.||||...|||||:|..||:||||.:..||.|.:::|...|...:.
 Frog    82 -LNLLHEEWPFGATFCNIYTSLDVMLCTASILNLFMISLDRYYGVTAPLRYSMHVTPFRVAIAMC 145

  Fly   263 NVWILPALISFTPIFLGWYTTEEHLREISLHPD-QCSFVVNKAYALISSSVSFWIPGIVMLVMYW 326
            .:|::..::||.||.|||.|.::.::......| :|...:||.|.|:...::|::|..:|.:||:
 Frog   146 VIWVVSLMVSFLPIHLGWNTKDKSIQNYRDSNDKECKLELNKEYVLVDGLLTFYLPLSIMCLMYY 210

  Fly   327 RIFKEAIRQRKALSRTS 343
            ||||.|..|.|.::..:
 Frog   211 RIFKIAREQAKRINHAN 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 76/199 (38%)
7tm_1 156..>344 CDD:278431 74/189 (39%)
hrh2XP_002938111.2 7tmA_Histamine_H2R 24..310 CDD:320179 78/205 (38%)
TM helix 1 25..51 CDD:320179 8/25 (32%)
TM helix 2 58..85 CDD:320179 11/27 (41%)
TM helix 3 96..126 CDD:320179 19/29 (66%)
TM helix 4 138..158 CDD:320179 4/19 (21%)
TM helix 5 186..216 CDD:320179 13/29 (45%)
TM helix 6 239..269 CDD:320179
TM helix 7 278..303 CDD:320179
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H40613
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.