DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and LOC100490372

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:XP_002937327.2 Gene:LOC100490372 / 100490372 -ID:- Length:405 Species:Xenopus tropicalis


Alignment Length:205 Identity:80/205 - (39%)
Similarity:122/205 - (59%) Gaps:13/205 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 GFIFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGGKWM 207
            |.:.:.|.|...||||:|.|.....::||.:|..|::||||||:|||...|.|:...|:: |.|:
 Frog    59 GSLLTVIDLITFLGNAVVFICPVVEKRLRTVTYMFIMSLAMADLLVACLVMPFSIIYEVT-GMWL 122

  Fly   208 FGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALIS 272
            ||...|.|:.|.||.|.||||:.||.||:|||.::|.|..|...|:.:....|...:|:..:|||
 Frog   123 FGKQFCKVWISFDVMFCTASIVTLCFISLDRYCSVVTPYHYSKRMSRRRCIIMTVTIWVYSSLIS 187

  Fly   273 FTPIFLGWYTTEEHLREI-SLHPD---QCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEA- 332
            |.|:..||       .|| .:..|   ||.||.|..:|:::||::|:||.|:|..||:.|::.: 
 Frog   188 FLPVMQGW-------NEIPGVDTDNGKQCIFVTNWTFAIVASSLAFYIPFIIMCSMYFFIYRASR 245

  Fly   333 IRQRKALSRT 342
            ::..:.:|:|
 Frog   246 LKATRIVSQT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 79/202 (39%)
7tm_1 156..>344 CDD:278431 76/192 (40%)
LOC100490372XP_002937327.2 7tmA_amine_R-like 58..346 CDD:320098 80/205 (39%)
TM helix 1 58..83 CDD:320098 9/23 (39%)
TM helix 2 90..117 CDD:320098 13/26 (50%)
TM helix 3 128..158 CDD:320098 17/29 (59%)
TM helix 4 170..190 CDD:320098 6/19 (32%)
TM helix 5 214..270 CDD:320098 14/42 (33%)
TM helix 6 271..301 CDD:320098
TM helix 7 311..339 CDD:320098
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D328277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.