Sequence 1: | NP_001034048.2 | Gene: | Octbeta3R / 3885573 | FlyBaseID: | FBgn0250910 | Length: | 1256 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002937327.2 | Gene: | LOC100490372 / 100490372 | -ID: | - | Length: | 405 | Species: | Xenopus tropicalis |
Alignment Length: | 205 | Identity: | 80/205 - (39%) |
---|---|---|---|
Similarity: | 122/205 - (59%) | Gaps: | 13/205 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 143 GFIFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGGKWM 207
Fly 208 FGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALIS 272
Fly 273 FTPIFLGWYTTEEHLREI-SLHPD---QCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEA- 332
Fly 333 IRQRKALSRT 342 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Octbeta3R | NP_001034048.2 | 7tm_4 | 146..>346 | CDD:304433 | 79/202 (39%) |
7tm_1 | 156..>344 | CDD:278431 | 76/192 (40%) | ||
LOC100490372 | XP_002937327.2 | 7tmA_amine_R-like | 58..346 | CDD:320098 | 80/205 (39%) |
TM helix 1 | 58..83 | CDD:320098 | 9/23 (39%) | ||
TM helix 2 | 90..117 | CDD:320098 | 13/26 (50%) | ||
TM helix 3 | 128..158 | CDD:320098 | 17/29 (59%) | ||
TM helix 4 | 170..190 | CDD:320098 | 6/19 (32%) | ||
TM helix 5 | 214..270 | CDD:320098 | 14/42 (33%) | ||
TM helix 6 | 271..301 | CDD:320098 | |||
TM helix 7 | 311..339 | CDD:320098 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D328277at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |