DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and adrb2

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001116897.2 Gene:adrb2 / 100144654 XenbaseID:XB-GENE-494302 Length:419 Species:Xenopus tropicalis


Alignment Length:310 Identity:108/310 - (34%)
Similarity:159/310 - (51%) Gaps:52/310 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SSPFSSYLSSDSTFE-LLSTVGPNITANGSDIAVDNQAELEESWLDLSLLLLKGFIFSSIILAAV 154
            :||:     .:||.| |:|.|  :.|:|.||...|       :|     ::..|.|.|.|:|..|
 Frog     7 ASPY-----PNSTLEQLVSNV--SNTSNASDKPGD-------AW-----MVGMGIIMSCIVLVIV 52

  Fly   155 LGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMCNVYNSL 219
            |||.|||.::.:.::|:.:||||:.|||.||:|:.|..:.|.|| .:....|:|..|.|..:.|:
 Frog    53 LGNVLVITAIAKFQRLQTVTNYFITSLACADLLMGLIVVPFGAS-SIILDTWVFNNFWCEFWTSV 116

  Fly   220 DVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYTTE 284
            |:...||||..||.|:||||:||..|..|...:|......::..||::..|.||.||::.||..|
 Frog   117 DILCVTASIETLCVIAVDRYFAITSPFRYQSLLTKCKARIVILLVWVVSTLTSFLPIYMHWYRIE 181

  Fly   285 EHLREISLH----PDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKALSRTSSN 345
            |   |.:||    |..|.|..|.|||:.||.:||::|.:||:.:|.|:|:||.:|.|.:.::...
 Frog   182 E---ESALHCYDDPSCCFFFTNPAYAISSSIISFYLPLVVMIFVYARVFQEAKKQLKKIDKSEGR 243

  Fly   346 ILLNSVHMGHTQQPTSLSYLHPSDCDLNATSAREET-------HSALSNL 388
            .     |..:.||            |.|.....:.|       |.||..|
 Frog   244 F-----HNQNNQQ------------DTNGKQGNKRTSKFWLKEHKALKTL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 82/203 (40%)
7tm_1 156..>344 CDD:278431 77/191 (40%)
adrb2NP_001116897.2 7tmA_Beta2_AR 38..337 CDD:341355 94/260 (36%)
TM helix 1 39..65 CDD:341355 12/25 (48%)
TM helix 2 72..99 CDD:341355 14/27 (52%)
TM helix 3 110..140 CDD:341355 15/29 (52%)
TM helix 4 152..175 CDD:341355 7/22 (32%)
TM helix 5 200..232 CDD:341355 16/31 (52%)
TM helix 6 267..297 CDD:341355 4/10 (40%)
TM helix 7 306..331 CDD:341355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14086
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.