DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and adrb2b

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001082940.2 Gene:adrb2b / 100037315 ZFINID:ZDB-GENE-070410-32 Length:409 Species:Danio rerio


Alignment Length:286 Identity:100/286 - (34%)
Similarity:148/286 - (51%) Gaps:34/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 NITA--NGS---DIAVDNQAELEESWLDLSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLRV 172
            ||:|  |.|   .::|...::.|        ::|...:...::|..|.||||||.::.|.::|:.
Zfish    17 NISAGLNASSPVSLSVSEYSDAE--------VVLISILIGILVLVIVFGNALVISAIVRFQRLQT 73

  Fly   173 ITNYFVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVD 237
            :||||:.|||.||:::.|..:.|.|...|. ..|.||.|.|..:.:.||...||||..||.|::|
Zfish    74 VTNYFISSLACADLVMGLMVVPFGACYILL-NTWHFGNFFCEFWTATDVLCVTASIETLCVIALD 137

  Fly   238 RYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYTTEEH-----LREISLHPDQC 297
            ||.||:.||.|...:|.:..|.|:..||.:.|||||.||.:.|:.::|.     |.|    |..|
Zfish   138 RYIAIMWPLRYQSMLTKRKACGMVIGVWAVAALISFLPIHMEWWVSDEPEALSCLEE----PTCC 198

  Fly   298 SFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKALSRTSSNILLNSVHMGHTQQPTSL 362
            .|..|.|||:.||.:||:||.::|..:|.|:|:||.||.:.:.|....|...|:   .||:...:
Zfish   199 DFNTNAAYAVTSSIISFYIPLVIMAFVYSRVFQEARRQLQKIDRIEGRIRTQSL---STQEGNEI 260

  Fly   363 SYLHPSDCDLNATSAREETHSALSNL 388
            .......|        .:.|.||..|
Zfish   261 KNRRTKFC--------MKDHKALKTL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 83/204 (41%)
7tm_1 156..>344 CDD:278431 81/192 (42%)
adrb2bNP_001082940.2 7tm_GPCRs 41..339 CDD:333717 93/254 (37%)
TM helix 1 43..67 CDD:320095 8/23 (35%)
TM helix 2 76..98 CDD:320095 10/21 (48%)
TM helix 3 114..136 CDD:320095 9/21 (43%)
TM helix 4 159..175 CDD:320095 8/15 (53%)
TM helix 5 204..227 CDD:320095 10/22 (45%)
TM helix 6 272..297 CDD:320095 4/7 (57%)
TM helix 7 308..333 CDD:320095
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.