DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and taar12a

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001076578.1 Gene:taar12a / 100034659 ZFINID:ZDB-GENE-041014-99 Length:343 Species:Danio rerio


Alignment Length:240 Identity:76/240 - (31%)
Similarity:119/240 - (49%) Gaps:25/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 DIAVDNQAELEESWL-------------DLSLLLLKGFIFSSI-ILAAVLGNALVIISVQRNRKL 170
            |:...||.:.|...|             .|:::.:..::|..: ||..|.||.::|||:...:.|
Zfish     9 DVMTSNQTQTENILLCYPLLSNSCPKLHRLAVVQVGLYVFLLLMILTTVFGNLMIIISISHFKHL 73

  Fly   171 RVITNYFVVSLAMADMLVALCAMTFN--ASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCC 233
            :..|:..|.|||..|.|:....|.::  .|||   |.|..|..:|.|:.|.||.|..:|:||||.
Zfish    74 QSPTHLIVQSLAACDCLMGSLVMPYSMVRSVE---GCWYLGDVVCKVHFSFDVTFCISSLLHLCL 135

  Fly   234 ISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYTTEEHLREISLHP---D 295
            ||||||.||..||.|.:.:|:.|:...:..:|:...:.||:.:|.|  .|...|..:.|..   .
Zfish   136 ISVDRYLAICDPLRYKIRVTNTTMTVFIIFIWLFSVVYSFSIVFSG--ITAVGLEMLILQTYCVG 198

  Fly   296 QCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKALS 340
            .|....||.:| :...::|:|.|.:|..:|.:||..|.:..|.:|
Zfish   199 SCVLFFNKEWA-VYPFLTFFITGAIMSSLYMKIFHVARKHAKVMS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 70/201 (35%)
7tm_1 156..>344 CDD:278431 66/190 (35%)
taar12aNP_001076578.1 7tm_4 57..328 CDD:304433 67/192 (35%)
7tm_1 59..316 CDD:278431 66/190 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.