Sequence 1: | NP_001034048.2 | Gene: | Octbeta3R / 3885573 | FlyBaseID: | FBgn0250910 | Length: | 1256 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001076571.1 | Gene: | taar13a / 100034639 | ZFINID: | ZDB-GENE-070424-256 | Length: | 341 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 65/205 - (31%) |
---|---|---|---|
Similarity: | 119/205 - (58%) | Gaps: | 8/205 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 145 IFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFN--ASVELSGGKWM 207
Fly 208 FGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALIS 272
Fly 273 FTPIF--LGWYTTEEHLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQ 335
Fly 336 RKALSRTSSN 345 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Octbeta3R | NP_001034048.2 | 7tm_4 | 146..>346 | CDD:304433 | 64/204 (31%) |
7tm_1 | 156..>344 | CDD:278431 | 61/191 (32%) | ||
taar13a | NP_001076571.1 | 7tm_1 | 49..309 | CDD:278431 | 62/194 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |