DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and taar13d

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001076510.1 Gene:taar13d / 100034379 ZFINID:ZDB-GENE-041014-62 Length:341 Species:Danio rerio


Alignment Length:205 Identity:62/205 - (30%)
Similarity:117/205 - (57%) Gaps:8/205 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 IFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFN--ASVELSGGKWM 207
            |.:|.:...:|||::||||:...::|:..||..|:|||:||:|:.|..|.|:  .||:   |.|.
Zfish    38 ILASAMTVTILGNSVVIISIAHFKQLQTTTNILVMSLALADLLLGLVVMPFSMIRSVD---GCWY 99

  Fly   208 FGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALIS 272
            :|...|.:::|.|::.::.||.||..|:|||:.|:..||:||..:|......|:...|.:.||.|
Zfish   100 YGETFCMLHSSFDLFLTSVSIFHLIFIAVDRHQAVCFPLQYPTMITIPVAWVMVMISWSMAALYS 164

  Fly   273 FTPIF--LGWYTTEEHLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQ 335
            :..::  ......:|:::.:.. ...|:...|..::::.:.::|::|..||:.:|.|||..|.:.
Zfish   165 YGLVYSKANMEGLDEYIQSMYC-VGGCTLYFNALWSVLDTLITFFLPCSVMIGLYARIFVVAKKH 228

  Fly   336 RKALSRTSSN 345
            .:.::..:.|
Zfish   229 ARIINEANQN 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 61/204 (30%)
7tm_1 156..>344 CDD:278431 58/191 (30%)
taar13dNP_001076510.1 7tm_1 49..309 CDD:278431 59/194 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.