DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and hrh2b

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001103208.1 Gene:hrh2b / 100005590 ZFINID:ZDB-GENE-070928-20 Length:335 Species:Danio rerio


Alignment Length:302 Identity:89/302 - (29%)
Similarity:144/302 - (47%) Gaps:64/302 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 IFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGGKWMFG 209
            :..:.|...:.||.||.::|..:|:|..:::.|::|||:.|:|:.|..:..:|.:||..|||..|
Zfish    10 VLVAFIALTICGNILVCMAVATSRRLHQLSSCFILSLAVTDLLLGLLVLPLSAMLELRNGKWPLG 74

  Fly   210 PFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFT 274
            ...||:|.|:||..|:||||.|..||||||.||..||.||..:|.:.|...|..:|.....:||.
Zfish    75 GVFCNIYISMDVMLSSASILTLLAISVDRYLAISNPLFYPRRVTPRRVAIALTAIWTCSLAVSFV 139

  Fly   275 PIFLGWYTTEEHLREI--SLHPD-----QCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIF--- 329
            .|.|||.:.:..::.:  |:..:     .|.:..|..|.|:.:...|::|.:||..||.|||   
Zfish   140 SINLGWNSPDFRVQNLDWSMWGEGEEGRTCRYEWNNNYVLLKAFGIFYLPLLVMCGMYHRIFCVA 204

  Fly   330 KEAIRQRKALSRTS--------------SNILLNSV----------------HMGHTQQPTSLSY 364
            :|.:|:.:|.:.:|              :.:.|.:|                :||       :..
Zfish   205 REQVRRIRAATPSSAQAANAAATAREHKATVTLAAVLGAFIICWFPYFTYFTYMG-------MWA 262

  Fly   365 LHPSDCDLNATSAREETHSAL-------SNLEDMLQPATDED 399
            :||:          :.|||.:       |.|..:|.||.:.|
Zfish   263 IHPN----------KLTHSIVLWLGYLNSALNPILYPALNRD 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 74/223 (33%)
7tm_1 156..>344 CDD:278431 73/211 (35%)
hrh2bNP_001103208.1 7tm_1 21..288 CDD:278431 84/283 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.