DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34015 and HINT2

DIOPT Version :9

Sequence 1:NP_001033848.1 Gene:CG34015 / 3885570 FlyBaseID:FBgn0054015 Length:139 Species:Drosophila melanogaster
Sequence 2:XP_024303470.1 Gene:HINT2 / 84681 HGNCID:18344 Length:165 Species:Homo sapiens


Alignment Length:108 Identity:25/108 - (23%)
Similarity:48/108 - (44%) Gaps:12/108 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFCLISDGRIPSTVLEVENDDFVIFQDIKPASQHHYLAVTKKHYASLKDLNKSHDSLVQLMENAL 71
            ||..|.|..:|:.:| .|:...::|:|:.|.:..|:|.:.||....:....:....|:..:....
Human    57 IFSRILDKSLPADIL-YEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVA 120

  Fly    72 KDLLVSKGVS------VDDALFGFHLPPFITVKHLHMHAISPR 108
            |....::|:.      ::|...|..     :|.|||:|.:..|
Human   121 KQTAKAEGLGDGYRLVINDGKLGAQ-----SVYHLHIHVLGGR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34015NP_001033848.1 HIT_like 5..106 CDD:294158 24/104 (23%)
HINT2XP_024303470.1 PKCI_related 55..157 CDD:238607 24/105 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.