DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34015 and HINT4

DIOPT Version :9

Sequence 1:NP_001033848.1 Gene:CG34015 / 3885570 FlyBaseID:FBgn0054015 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001319963.1 Gene:HINT4 / 827357 AraportID:AT4G16566 Length:173 Species:Arabidopsis thaliana


Alignment Length:117 Identity:50/117 - (42%)
Similarity:66/117 - (56%) Gaps:12/117 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADDN--CIFCLISDGRIPSTVLEVENDDFVI-FQDIKPASQHHYLAVTKKHYASLKDLNKSHD- 61
            ||..|  ||||.|.  |.|:|...:..|:.|| |||||||:|.|||.:.|:|..::.||.:..: 
plant     1 MAGVNQACIFCEIV--RNPTTTRLLHTDEKVIAFQDIKPAAQRHYLVIPKEHIPTVNDLQRRDED 63

  Fly    62 -SLVQLMENALKDLLVSKGVSVDDALFGFHLPPFITVKHLHMHAIS----PR 108
             |||:.|.:..:.|| .|........||||.|||.:|.|||:|..:    ||
plant    64 YSLVRHMLSVGQQLL-QKDAPQSIHRFGFHQPPFNSVDHLHLHCFALPYVPR 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34015NP_001033848.1 HIT_like 5..106 CDD:294158 46/105 (44%)
HINT4NP_001319963.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 74 1.000 Domainoid score I3239
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I2433
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1496385at2759
OrthoFinder 1 1.000 - - FOG0004937
OrthoInspector 1 1.000 - - otm3421
orthoMCL 1 0.900 - - OOG6_103575
Panther 1 1.100 - - LDO PTHR12486
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3479
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.930

Return to query results.
Submit another query.