DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34015 and hint3

DIOPT Version :9

Sequence 1:NP_001033848.1 Gene:CG34015 / 3885570 FlyBaseID:FBgn0054015 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001313397.1 Gene:hint3 / 796590 ZFINID:ZDB-GENE-100922-168 Length:160 Species:Danio rerio


Alignment Length:131 Identity:57/131 - (43%)
Similarity:80/131 - (61%) Gaps:5/131 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DDNCIFCLISDGRIPSTVLEVENDDFV-IFQDIKPASQHHYLAVTKKHYASLKDLNKSHDSLVQL 66
            |..||||.|..|.:.:.:|  .:|:.| .||||.|.:.||||.|..||..:.|.|:|.|..||:.
Zfish    23 DKKCIFCKILKGEMGTELL--HSDETVSCFQDIHPGAPHHYLVVPSKHVGNCKSLSKEHVPLVEK 85

  Fly    67 MENALKDLLVSKGVS-VDDALFGFHLPPFITVKHLHMHAISPRTQMTFLSKMIFR-PSVWFKTVD 129
            |....|::|....|: :.|..||||.|||.:|.|||:|.::|.:||.|:|::|:| .|.||.|.|
Zfish    86 MLETGKEILEKNNVTDLSDVRFGFHWPPFCSVTHLHLHVLAPVSQMGFMSRLIYRLNSYWFVTAD 150

  Fly   130 E 130
            :
Zfish   151 Q 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34015NP_001033848.1 HIT_like 5..106 CDD:294158 44/102 (43%)
hint3NP_001313397.1 HIT_like 25..126 CDD:294158 44/102 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580846
Domainoid 1 1.000 94 1.000 Domainoid score I7416
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12046
Inparanoid 1 1.050 108 1.000 Inparanoid score I4886
OMA 1 1.010 - - QHG49262
OrthoDB 1 1.010 - - D1496385at2759
OrthoFinder 1 1.000 - - FOG0004937
OrthoInspector 1 1.000 - - mtm6404
orthoMCL 1 0.900 - - OOG6_103575
Panther 1 1.100 - - LDO PTHR12486
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3692
SonicParanoid 1 1.000 - - X3479
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.