DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34015 and hint3

DIOPT Version :10

Sequence 1:NP_001033848.1 Gene:CG34015 / 3885570 FlyBaseID:FBgn0054015 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001039146.1 Gene:hint3 / 733971 XenbaseID:XB-GENE-1000078 Length:153 Species:Xenopus tropicalis


Alignment Length:92 Identity:21/92 - (22%)
Similarity:31/92 - (33%) Gaps:36/92 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 LKFLMALYA--QSGAF----------------------FLTCFTPYVYMLYSCFTNYYNPIANNF 272
            ||..:||.|  |.|||                      |..|..|.|.:..:..|   .|.....
 Frog   268 LKARVALLASLQDGAFQNALMISQLLPVLNHKTYIDLIFPDCLAPRVMLEPAAET---IPQTQEI 329

  Fly   273 IFIFVAARGSFCTVILLSAYKPYKKAV 299
            |.:         |:.:||...||::::
 Frog   330 ISV---------TLQVLSLLPPYRQSI 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34015NP_001033848.1 DcpS_C 5..116 CDD:463415
hint3NP_001039146.1 HIT_like 18..120 CDD:469672
Histidine triad motif 113..117
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.