DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34015 and hint3

DIOPT Version :9

Sequence 1:NP_001033848.1 Gene:CG34015 / 3885570 FlyBaseID:FBgn0054015 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001039146.1 Gene:hint3 / 733971 XenbaseID:XB-GENE-1000078 Length:153 Species:Xenopus tropicalis


Alignment Length:130 Identity:57/130 - (43%)
Similarity:79/130 - (60%) Gaps:2/130 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DDNCIFCLISDGRIPSTVLEVENDDFVIFQDIKPASQHHYLAVTKKHYASLKDLNKSHDSLVQLM 67
            |.:||||.|::.:.....|...:||.|.|:||:||..||||.|.|||..:.|.|.|.|..|::.|
 Frog    16 DMSCIFCRIANKQESGAELLHSDDDLVCFKDIRPAVTHHYLVVPKKHVGTCKTLTKDHVQLIKTM 80

  Fly    68 ENALKDLLVSKGVS-VDDALFGFHLPPFITVKHLHMHAISPRTQMTFLSKMIFR-PSVWFKTVDE 130
            ....|..|....|: ::|...|||.|||.::.|||:|.::|.:|:.|||:||:| .|.||.|.||
 Frog    81 MEVGKSTLQKNNVTDLEDIRLGFHYPPFCSISHLHLHVLAPASQLGFLSRMIYRVNSYWFITADE 145

  Fly   131  130
             Frog   146  145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34015NP_001033848.1 HIT_like 5..106 CDD:294158 42/101 (42%)
hint3NP_001039146.1 HIT_like 18..120 CDD:381879 42/101 (42%)
Histidine triad motif 113..117 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I6977
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12046
Inparanoid 1 1.050 114 1.000 Inparanoid score I4690
OMA 1 1.010 - - QHG49262
OrthoDB 1 1.010 - - D1496385at2759
OrthoFinder 1 1.000 - - FOG0004937
OrthoInspector 1 1.000 - - otm48900
Panther 1 1.100 - - LDO PTHR12486
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3692
SonicParanoid 1 1.000 - - X3479
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.