DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34015 and si:dkey-25e12.3

DIOPT Version :9

Sequence 1:NP_001033848.1 Gene:CG34015 / 3885570 FlyBaseID:FBgn0054015 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001020726.2 Gene:si:dkey-25e12.3 / 678527 ZFINID:ZDB-GENE-041001-132 Length:160 Species:Danio rerio


Alignment Length:132 Identity:52/132 - (39%)
Similarity:77/132 - (58%) Gaps:6/132 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DDNCIFCLISDGRIPSTVLEVENDDFVIFQDIKPASQHHYLAVTKKHYASLKDLNKSHDSLVQLM 67
            |..||||.|:.|....|.:..|::|||.|:||.|.:.||||.:.|||..|...|.....|||:.|
Zfish    20 DKTCIFCTIAKGDDRYTEILAEDEDFVCFRDINPGAPHHYLVIPKKHIYSCLSLYADDISLVRGM 84

  Fly    68 ENALKDLLVSKGVS-VDDALFGFHLPPFITVKHLHMHAISPRTQMTFLSKMIFRPSVWF----KT 127
            ....:::|.:..|: :.|...|||:||:|||.|||:|.::|.:|:...:...||.: |:    ||
Zfish    85 AEMGRNVLKANNVTDLKDISLGFHVPPYITVPHLHLHVLAPYSQLYKWAINKFRTN-WYINEEKT 148

  Fly   128 VD 129
            |:
Zfish   149 VE 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34015NP_001033848.1 HIT_like 5..106 CDD:294158 43/101 (43%)
si:dkey-25e12.3NP_001020726.2 HIT_like 22..124 CDD:294158 43/101 (43%)
Histidine triad motif 117..121 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580845
Domainoid 1 1.000 94 1.000 Domainoid score I7416
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I4886
OMA 1 1.010 - - QHG49262
OrthoDB 1 1.010 - - D1496385at2759
OrthoFinder 1 1.000 - - FOG0004937
OrthoInspector 1 1.000 - - mtm6404
orthoMCL 1 0.900 - - OOG6_103575
Panther 1 1.100 - - O PTHR12486
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3479
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.