DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34015 and Hint3

DIOPT Version :9

Sequence 1:NP_001033848.1 Gene:CG34015 / 3885570 FlyBaseID:FBgn0054015 Length:139 Species:Drosophila melanogaster
Sequence 2:XP_006512886.1 Gene:Hint3 / 66847 MGIID:1914097 Length:200 Species:Mus musculus


Alignment Length:174 Identity:65/174 - (37%)
Similarity:91/174 - (52%) Gaps:42/174 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DDNCIFCLISDGRIPSTVL-EVENDDFVIFQDIKPASQHHYLAVTKKHYASLKDLNKSHDSLV-- 64
            |.||:||.::.|:.|.|.| ..||:|.|.|:|||||:.:|||.|.|||..|.|||||.|..:|  
Mouse    28 DSNCVFCRVAAGQEPKTELFHCENEDLVCFKDIKPAALYHYLVVPKKHIGSCKDLNKDHIEMVYS 92

  Fly    65 -----------------------QLMENAL--KDLLVSKGVSV---------DDALFGFHLPPFI 95
                                   ::.|..|  .:.:|:.|.::         .|...|||:|||.
Mouse    93 RSVLVAVFTRVWVSLAVLYGTLQRINETRLFRVESMVAAGKTMLERNNFTDFTDVRMGFHVPPFC 157

  Fly    96 TVKHLHMHAISPRTQMTFLSKMIFR-PSVWFKTVDEARIYLSQK 138
            ::.|||:|.|:|..:..||||:::| .|.||.|||    ||.:|
Mouse   158 SISHLHLHVIAPVKEFGFLSKLVYRQDSYWFVTVD----YLLEK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34015NP_001033848.1 HIT_like 5..106 CDD:294158 48/137 (35%)
Hint3XP_006512886.1 aprataxin_related 30..168 CDD:238609 48/137 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837246
Domainoid 1 1.000 106 1.000 Domainoid score I6584
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12046
Inparanoid 1 1.050 125 1.000 Inparanoid score I4680
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49262
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004937
OrthoInspector 1 1.000 - - otm43730
orthoMCL 1 0.900 - - OOG6_103575
Panther 1 1.100 - - LDO PTHR12486
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3692
SonicParanoid 1 1.000 - - X3479
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.