DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34015 and hint1

DIOPT Version :9

Sequence 1:NP_001033848.1 Gene:CG34015 / 3885570 FlyBaseID:FBgn0054015 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001016165.1 Gene:hint1 / 548919 XenbaseID:XB-GENE-1014427 Length:126 Species:Xenopus tropicalis


Alignment Length:125 Identity:33/125 - (26%)
Similarity:55/125 - (44%) Gaps:23/125 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADD-----------NCIFCLISDGRIPSTVLEVENDDFVIFQDIKPASQHHYLAVTKKHYASLK 54
            |||:           :.||..|....||:.:: .|::..:.|.||.|.:..|:|.|.||....|.
 Frog     1 MADEISKAQTACPGGDTIFGKIIRKEIPAKII-YEDEQCIAFHDIAPQAPVHFLVVPKKFITHLS 64

  Fly    55 DLNKSHDSLV-QLM---ENALKDLLVSKG--VSVDDALFGFHLPPFITVKHLHMHAISPR 108
            ..:.:.:.|: .||   .....||.::.|  ::|::...|..     :|.|||:|....|
 Frog    65 KADPADEKLLGHLMIVGSKCAADLGLTNGYRLAVNEGPDGGQ-----SVYHLHLHVFGGR 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34015NP_001033848.1 HIT_like 5..106 CDD:294158 29/106 (27%)
hint1NP_001016165.1 PKCI_related 16..118 CDD:238607 29/107 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.