DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34015 and CG15362

DIOPT Version :9

Sequence 1:NP_001033848.1 Gene:CG34015 / 3885570 FlyBaseID:FBgn0054015 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_608634.1 Gene:CG15362 / 33371 FlyBaseID:FBgn0031378 Length:168 Species:Drosophila melanogaster


Alignment Length:137 Identity:65/137 - (47%)
Similarity:90/137 - (65%) Gaps:1/137 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DNCIFCLISDGRI-PSTVLEVENDDFVIFQDIKPASQHHYLAVTKKHYASLKDLNKSHDSLVQLM 67
            :.|.||..:..|. |..:||||.|::|||:|..||::.||||:.|:|:.|||.|||||..||:.|
  Fly    31 EKCFFCDFAHRRQGPPPILEVETDEYVIFKDKYPAARLHYLAIPKEHFDSLKALNKSHVGLVRRM 95

  Fly    68 ENALKDLLVSKGVSVDDALFGFHLPPFITVKHLHMHAISPRTQMTFLSKMIFRPSVWFKTVDEAR 132
            |..:.:.|.|:.|...:|:.||||||||:|:|||:|.|.|...|:|.:|:.|.||.|||...:|.
  Fly    96 EQGMMEFLRSQNVDPKEAIVGFHLPPFISVRHLHLHGIFPPADMSFGNKISFMPSFWFKKSSDAI 160

  Fly   133 IYLSQKE 139
            ..|..:|
  Fly   161 RELEDRE 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34015NP_001033848.1 HIT_like 5..106 CDD:294158 51/101 (50%)
CG15362NP_608634.1 aprataxin_related 32..134 CDD:238609 51/101 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449307
Domainoid 1 1.000 74 1.000 Domainoid score I3239
eggNOG 1 0.900 - - E1_COG0537
Homologene 1 1.000 - - H12046
Inparanoid 1 1.050 74 1.000 Inparanoid score I2433
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49262
OrthoDB 1 1.010 - - D1496385at2759
OrthoFinder 1 1.000 - - FOG0004937
OrthoInspector 1 1.000 - - mtm6404
orthoMCL 1 0.900 - - OOG6_103575
Panther 1 1.100 - - P PTHR12486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3479
1312.810

Return to query results.
Submit another query.