DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34015 and nft-1

DIOPT Version :9

Sequence 1:NP_001033848.1 Gene:CG34015 / 3885570 FlyBaseID:FBgn0054015 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_499556.1 Gene:nft-1 / 176628 WormBaseID:WBGene00003594 Length:440 Species:Caenorhabditis elegans


Alignment Length:137 Identity:29/137 - (21%)
Similarity:52/137 - (37%) Gaps:24/137 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IPSTVLEVENDDFVIFQDIKPASQHHYLAVTKKHYASLKDLNKSHDSLVQLMENALKDLL----- 75
            ||:..:........:|.::||.:..|.|...|:....|.||..:..:.:.::...::.:|     
 Worm   306 IPADHIFYSTPHSFVFVNLKPVTDGHVLVSPKRVVPRLTDLTDAETADLFIVAKKVQAMLEKHHN 370

  Fly    76 -VSKGVSVDDALFGFHLPPFITVKHLHMHAISPRTQMTFLSKMIF------------RPSVWFKT 127
             .|..:.|.|......     ||.|:|:| |.||....|....|:            :|....:.
 Worm   371 VTSTTICVQDGKDAGQ-----TVPHVHIH-ILPRRAGDFGDNEIYQKLASHDKEPERKPRSNEQM 429

  Fly   128 VDEARIY 134
            .:||.:|
 Worm   430 AEEAVVY 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34015NP_001033848.1 HIT_like 5..106 CDD:294158 20/95 (21%)
nft-1NP_499556.1 nit 17..281 CDD:143596
FHIT 300..418 CDD:238606 25/117 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.