DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34026 and CG13323

DIOPT Version :9

Sequence 1:NP_001033839.1 Gene:CG34026 / 3885569 FlyBaseID:FBgn0054026 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001286370.1 Gene:CG13323 / 36433 FlyBaseID:FBgn0033788 Length:112 Species:Drosophila melanogaster


Alignment Length:119 Identity:36/119 - (30%)
Similarity:53/119 - (44%) Gaps:18/119 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IILFALAAFILPTFAANDYLWGEVGADDYQLAKDTVSKAFFVGLVQTKKYVFKQSDNLNA----- 65
            :||..:.|.||...|.. ..||....:||.|::.|          :.:..:.....|:|.     
  Fly     5 LILSVVLAVILGCHAYG-ATWGRRNNNDYLLSRTT----------EVRNPIKNNYWNVNVNYPAG 58

  Fly    66 -LTITAIKITDK-KKSHGATAVLVSGGPGSKGATIKFTSERGYGIKDIVEIWGR 117
             ..|:|:.:.|. |.:.||:..|.|||||.:.||:....:...||...||||||
  Fly    59 FYNISAVIVYDNFKNNSGASPSLYSGGPGYRFATVNLRGQVNRGINSTVEIWGR 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34026NP_001033839.1 MBF2 26..116 CDD:292493 27/96 (28%)
CG13323NP_001286370.1 MBF2 24..111 CDD:292493 27/96 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471745
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D138395at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.