DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34026 and CG30413

DIOPT Version :9

Sequence 1:NP_001033839.1 Gene:CG34026 / 3885569 FlyBaseID:FBgn0054026 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_726308.1 Gene:CG30413 / 246601 FlyBaseID:FBgn0050413 Length:122 Species:Drosophila melanogaster


Alignment Length:106 Identity:49/106 - (46%)
Similarity:61/106 - (57%) Gaps:5/106 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FILPTFAA---NDYLWGEVGADDYQLAKDTVSKAFFVGLVQTKKYVFKQSDNLNALTITAIKITD 75
            ||...|.:   |||.:|.....|..:|.:|::|:..:..:.||.|...|:.  .|.|||.|||||
  Fly    17 FIDANFGSGEGNDYTYGTQATTDTLIASETITKSKSLLGITTKTYTLTQAG--TAKTITYIKITD 79

  Fly    76 KKKSHGATAVLVSGGPGSKGATIKFTSERGYGIKDIVEIWG 116
            .||..||||.:.|||.||...||||||.||.|||..|.|:|
  Fly    80 LKKMRGATAEITSGGVGSTTVTIKFTSARGAGIKSQVVIYG 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34026NP_001033839.1 MBF2 26..116 CDD:292493 42/89 (47%)
CG30413NP_726308.1 MBF2 33..120 CDD:292493 42/88 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471740
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCZY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0020000
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.