DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34026 and LOC1277050

DIOPT Version :10

Sequence 1:NP_001033839.1 Gene:CG34026 / 3885569 FlyBaseID:FBgn0054026 Length:117 Species:Drosophila melanogaster
Sequence 2:XP_316478.4 Gene:LOC1277050 / 1277050 VectorBaseID:AGAMI1_002626 Length:119 Species:Anopheles gambiae


Alignment Length:51 Identity:18/51 - (35%)
Similarity:24/51 - (47%) Gaps:1/51 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ITAIKITDK-KKSHGATAVLVSGGPGSKGATIKFTSERGYGIKDIVEIWGR 117
            ||||...|. ....|..|.:||||......|:|.||:........:||:|:
Mosquito    69 ITAIFTRDNVPGGKGGFAGIVSGGVNQSNVTLKLTSKPYQRFNFTIEIYGK 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34026NP_001033839.1 MBF2 26..116 CDD:464913 17/48 (35%)
LOC1277050XP_316478.4 MBF2 26..118 CDD:464913 17/48 (35%)

Return to query results.
Submit another query.