DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk3 and AT1G73460

DIOPT Version :9

Sequence 1:NP_001033810.1 Gene:Dyrk3 / 3885567 FlyBaseID:FBgn0027101 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_001319375.1 Gene:AT1G73460 / 843681 AraportID:AT1G73460 Length:1169 Species:Arabidopsis thaliana


Alignment Length:476 Identity:148/476 - (31%)
Similarity:235/476 - (49%) Gaps:68/476 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 TSPSKTKDVPGLFLRTISENSKSKSEPECESLISV------KESSVME--NHTFLFHEQIIMSGQ 195
            :|.|..||.....:::::.:..|.|...||.....      .:||.:|  |.|.|..|:.:...:
plant   748 SSHSSVKDNNATSIKSLNSSPSSLSNYACEERKHADKEDDRNDSSEIEDDNATALDDEEAVAVQE 812

  Fly   196 QKCELHEKPKVLVVSPQQVMILYMNKLTPYERTEILTYPQIYFIGANAKKRPGVYGPNNSEYDNE 260
            |         |..:..|:         ..:|..::..                |:..|.:.::.|
plant   813 Q---------VRQIKAQE---------EEFETFDLKI----------------VHRKNRTGFEEE 843

  Fly   261 QGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRFHRQAQEEIRILH 325
            :...: |.:..:|.||.:.:.:|..:|.:.|:|:|.:|...|.:||::|.|.|..|:.:||::|.
plant   844 KNFNV-VLNSVIAGRYHVTEYLGSAAFSKAIQAHDLQTGMDVCIKIIKNNKDFFDQSLDEIKLLK 907

  Fly   326 HLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKG----FSLQLVRKFAHSL 386
            ::.:||..:..:::.::|||.:|.|..|..|||..||||..|.|...|    |::..::......
plant   908 YVNKHDPADKYHLLRLYDYFYYREHLLIVCELLKANLYEFHKFNRESGGEVYFTMPRLQSITIQC 972

  Fly   387 LQCLDALYKNDIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGG 451
            |:.|..|:...:||||:||||:|:|...|..|||||.||||||...:.:|:|||.|||||||||.
plant   973 LESLQFLHGLGLIHCDLKPENILVKSYSRCEIKVIDLGSSCFETDHLCSYVQSRSYRAPEVILGL 1037

  Fly   452 KYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKNILASSKRSKSFFSPKG-- 514
            .|.:.||:||||||||||.:|:.||..::.:..||.::.::|..:..:|...:.|..:|:...  
plant  1038 PYDKKIDVWSLGCILAELCTGNVLFQNDSPASLLARVMGIVGSFDNEMLTKGRDSHKYFTKNRML 1102

  Fly   515 YPRYCTVRTMSDGMVVLIGGQSRRGKQRGPPCSKSLSKALDGCKDPLFLNFIRGCLEWDADKRLT 579
            |.|    ...|:.:..||            |...||...|. ..|..|.:|:...||.:..||.:
plant  1103 YER----NQESNRLEYLI------------PKRTSLRHRLP-MGDQGFTDFVAHLLEINPKKRPS 1150

  Fly   580 PSEALKHPWLRRRLPRPPSSS 600
            .:||||||||  ..|..|.|:
plant  1151 AAEALKHPWL--SYPYEPISA 1169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk3NP_001033810.1 PKc_DYRK2_3 211..589 CDD:271126 126/383 (33%)
S_TKc 276..589 CDD:214567 118/318 (37%)
AT1G73460NP_001319375.1 PKc_DYRK_like 858..1160 CDD:271035 118/318 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.