DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk3 and AT4G03175

DIOPT Version :9

Sequence 1:NP_001033810.1 Gene:Dyrk3 / 3885567 FlyBaseID:FBgn0027101 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_001319857.1 Gene:AT4G03175 / 828048 AraportID:AT4G03175 Length:98 Species:Arabidopsis thaliana


Alignment Length:117 Identity:38/117 - (32%)
Similarity:54/117 - (46%) Gaps:23/117 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 LACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRGKQRGPPCSKS 549
            ||.|:.|||.....:|...:.:..:|: |.|..| .:...|:.:..:|..:|            |
plant     3 LARIVAVLGPIETEMLKKGQETHKYFT-KEYDLY-HLNEESNEIEYIITEES------------S 53

  Fly   550 LSKALDGCKDPLFLNFIRGCLEWDADKRLTPSEALKHPWLRRRLPRPPSSSS 601
            |.:.|. ..|.|||:|:|..||.:..:|.|..|||.||||        ||||
plant    54 LEEQLQ-VSDELFLDFVRTLLEINPLRRPTALEALNHPWL--------SSSS 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk3NP_001033810.1 PKc_DYRK2_3 211..589 CDD:271126 32/103 (31%)
S_TKc 276..589 CDD:214567 32/103 (31%)
AT4G03175NP_001319857.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.