DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk3 and AT3G53640

DIOPT Version :9

Sequence 1:NP_001033810.1 Gene:Dyrk3 / 3885567 FlyBaseID:FBgn0027101 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_190932.1 Gene:AT3G53640 / 824532 AraportID:AT3G53640 Length:642 Species:Arabidopsis thaliana


Alignment Length:386 Identity:134/386 - (34%)
Similarity:190/386 - (49%) Gaps:52/386 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 NKLTPYERTEILTYPQIYFIGANAKKRPGVYGPNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGK 284
            |.|.|:.|:.:                       |..:|:.:|.|.:...:.:..|||::...||
plant   290 NALVPFVRSGL-----------------------NDNWDDAEGYYSYQLGELLDDRYEIMATHGK 331

  Fly   285 GSFGQVIKAYDHKTH----EHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYF 345
            |.|..|::|.|.|..    |.||:||:|..:..|:..|.|||||..|...|..|..:.:.:...|
plant   332 GVFSTVVRAKDTKPELGEPEEVAIKIIRKNETMHKAGQAEIRILKKLVCSDPENKHHCVRLLSTF 396

  Fly   346 TFRNHTCITFELLSINLYELIKKNGFK-GFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVL 409
            .:|||.|:.||.|.:||.|::||.|.. |..|..||.:|..|...|..|....::|||:||:|:|
plant   397 EYRNHLCLVFESLHLNLREVVKKIGVNIGLKLYDVRVYAEQLFISLKHLKNCGVLHCDIKPDNIL 461

  Fly   410 LKQQGRSGIKVIDFGSSCF--ENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSG 472
            : .:||:.:|:.||||:.|  ||| :..|:.||||||||:|||..|...:|:||:||.|.||.||
plant   462 M-NEGRNMLKLCDFGSAMFAGENQ-VTPYLVSRFYRAPEIILGLPYDHPLDIWSVGCCLYELYSG 524

  Fly   473 HALFPGENESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSR 537
            ..:|||...:|.|...:|:.|...|.:|    |..:|.........|...|..|.:.   |...|
plant   525 KIMFPGSTNNDMLRLHMELKGPFPKKML----RKGAFIDQHFDKDLCFYATEEDSVT---GKTIR 582

  Fly   538 RGKQRGPPCSKSLSKAL-----DGCKDPLFLNFIRGCLE----WDADKRLTPSEALKHPWL 589
            |......|  |.|...:     |  :||..|...|..|:    .|..||||.|:||.||::
plant   583 RIMVNVKP--KDLGSVIRRRYED--EDPKVLVHFRNLLDKIFTLDPQKRLTVSQALAHPFI 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk3NP_001033810.1 PKc_DYRK2_3 211..589 CDD:271126 134/384 (35%)
S_TKc 276..589 CDD:214567 125/328 (38%)
AT3G53640NP_190932.1 U79_P34 <75..130 CDD:281109
STKc_PRP4 322..639 CDD:271037 126/329 (38%)
S_TKc 323..639 CDD:214567 125/328 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D870358at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.