DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk3 and AT3G25840

DIOPT Version :9

Sequence 1:NP_001033810.1 Gene:Dyrk3 / 3885567 FlyBaseID:FBgn0027101 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_189213.2 Gene:AT3G25840 / 822178 AraportID:AT3G25840 Length:935 Species:Arabidopsis thaliana


Alignment Length:599 Identity:155/599 - (25%)
Similarity:255/599 - (42%) Gaps:104/599 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ELSETPATDKNNLNTTHLENTQLSKALSPPTSLPQIQIQMINQNLTHTGIA-----QNNTEKANR 72
            :|.||.|.|:.:.|....::.........|....:..:..|.:.......|     :...|:.|.
plant   416 KLEETWANDERSRNEDGQDDNDEGLTWKSPEEEEEELLNRIKEESRKRMEAILEKHKRKPEQQNE 480

  Fly    73 HQYRDSGLQYLTRCFEPLAMLNDSKEDFPTQPSNNIANYPGDIQILPIFDCCEISESIQAISLPN 137
            ...:|:|...:.....|::          |.|:..||...|..:....||.......:.|...|.
plant   481 LLTQDNGKDIVPETGAPVS----------TSPAVVIAANVGQAKTNLDFDTVAAKAPLIAGGPPT 535

  Fly   138 VTSPSKTKDVPGLFLRTISENSKSKSEPECESLISVKESS-VMENHTFLFHEQIIMSGQQKCELH 201
            ::.              ||::.|::::      ..:.|.| ..|....:||:.|.  |:....:.
plant   536 MSG--------------ISDSEKNQAQ------AGLGEGSPKSERSADMFHDDIF--GESPAGIR 578

  Fly   202 EKPKVLVVSPQQVMILYMNKLTPYERTEILTYPQIYFIGANAKKRPGVYGPNNSEYDNEQGAYIH 266
            :                                    :|......|.|....:..:|:.:|.|.:
plant   579 K------------------------------------VGGKGDGVPMVRSGLHDNWDDAEGYYSY 607

  Fly   267 VPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKT----HEHVALKIVRNEKRFHRQAQEEIRILHHL 327
            ...:.:..|||::...|||.|..|::|.|.|.    .|.||:||:||.:..|:..:.|::||..|
plant   608 QFGELLDGRYEVIATHGKGVFSTVVRAKDLKAGPAEPEEVAIKIIRNNETMHKAGKIEVQILKKL 672

  Fly   328 RRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFK-GFSLQLVRKFAHSLLQCLD 391
            ...|:.:..:.:.....|.:|||.|:.||.|.:||.|::||.|.. |..|..||.::..|...|.
plant   673 AGADREDRRHCVRFLSSFKYRNHLCLVFESLHLNLREVLKKFGRNIGLQLSAVRAYSKQLFIALK 737

  Fly   392 ALYKNDIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQRIYT-YIQSRFYRAPEVILGGKYGR 455
            .|....::|||:||:|:|: .:|::.:|:.|||::.|..:...| |:.|||||:||:|||..|..
plant   738 HLKNCGVLHCDIKPDNMLV-NEGKNVLKLCDFGNAMFAGKNEVTPYLVSRFYRSPEIILGLTYDH 801

  Fly   456 AIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLG-MPNKNILASSKRSKSFFSPKGYPRYC 519
            .:|:||:||.|.||.||..||||...:|.|...:|:.| .|.|.:...:...:.|.....:  |.
plant   802 PLDIWSVGCCLYELYSGKVLFPGATNNDMLRLHMELKGPFPKKMLRKGAFIDQHFDHDLNF--YA 864

  Fly   520 TVRTMSDG-----MVVLIGGQSRRGKQRGPPCSKSLSKALDGCKDPLFLNFIRGCLE----WDAD 575
            |......|     |:|.:     :.|..|     |:.|...| :||..|...|..|:    .|.:
plant   865 TEEDTVSGKLIKRMIVNV-----KPKDFG-----SIIKGYPG-EDPKILAHFRDLLDKMFILDPE 918

  Fly   576 KRLTPSEALKHPWL 589
            :|||.|:||.||::
plant   919 RRLTVSQALAHPFI 932

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk3NP_001033810.1 PKc_DYRK2_3 211..589 CDD:271126 122/393 (31%)
S_TKc 276..589 CDD:214567 115/328 (35%)
AT3G25840NP_189213.2 PRP38_assoc 186..266 CDD:289628
DUF1777 315..>439 CDD:285811 6/22 (27%)
STKc_PRP4 616..932 CDD:271037 116/329 (35%)
S_TKc 617..932 CDD:214567 115/328 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.