DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk3 and clk2b

DIOPT Version :9

Sequence 1:NP_001033810.1 Gene:Dyrk3 / 3885567 FlyBaseID:FBgn0027101 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_001070219.1 Gene:clk2b / 767784 ZFINID:ZDB-GENE-060929-1126 Length:500 Species:Danio rerio


Alignment Length:381 Identity:103/381 - (27%)
Similarity:190/381 - (49%) Gaps:61/381 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 DNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDH-KTHEHVALKIVRNEKRFHRQAQEEI 321
            |:|:|..|:...|.:..|||:.:.:|:|:||:|::..|| :....:||||::|.:::...|:.||
Zfish   149 DDEEGHLIYRAGDVLQDRYEITQTLGEGTFGKVVECVDHQRGGSRIALKIIKNVEKYKEAARLEI 213

  Fly   322 RILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAHSL 386
            .:|..:.:.|..|....:.|.|:|.:..|.|::||||.::.::.:|:|.:..:|:..||..|:.:
Zfish   214 NVLEKINQRDPENKNLCVQMLDWFDYHGHMCLSFELLGLSTFDFMKENNYLPYSISQVRHMAYQI 278

  Fly   387 LQCLDALYKNDIIHCDMKPENVLL-------------KQQGRS----GIKVIDFGSSCFENQRIY 434
            ...:..|:.|.:.|.|:||||:|.             |:..||    .::::||||:.|:::...
Zfish   279 CLAVKFLHDNKLTHTDLKPENILFVSSDYSVLYNAEKKRDERSVNSTAVRIVDFGSATFDHEHHS 343

  Fly   435 TYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKNI 499
            :.:.:|.||||||||...:.:..|:||:||||.|...|:.|:...:..:.||.:..:.|.....:
Zfish   344 SIVSTRHYRAPEVILELGWSQPCDVWSIGCILFEFYCGYTLYQTHDNREHLAMMERIHGPVPSRM 408

  Fly   500 LASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRGKQRGPPCSKSLSKALDGCKDPL--- 561
            :..:::.|.|:                           ||:......:.:.....:.|: ||   
Zfish   409 IRKTRKQKYFY---------------------------RGRLDWDESTSAGRYVRENCR-PLRRY 445

  Fly   562 ----------FLNFIRGCLEWDADKRLTPSEALKHPWLRRRLPRPPSSSSGCGGVS 607
                      |.:.:.|.||::.::||:.|.||:||:.  .|.|.....||...:|
Zfish   446 MLCESEDHHQFFDLLEGLLEYEPEQRLSLSAALRHPFF--SLLRDTEHFSGGRDIS 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk3NP_001033810.1 PKc_DYRK2_3 211..589 CDD:271126 98/361 (27%)
S_TKc 276..589 CDD:214567 92/343 (27%)
clk2bNP_001070219.1 PKc_like 154..483 CDD:304357 95/356 (27%)
S_TKc 167..483 CDD:214567 92/343 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.