DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk3 and CLK4

DIOPT Version :9

Sequence 1:NP_001033810.1 Gene:Dyrk3 / 3885567 FlyBaseID:FBgn0027101 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_065717.1 Gene:CLK4 / 57396 HGNCID:13659 Length:481 Species:Homo sapiens


Alignment Length:375 Identity:116/375 - (30%)
Similarity:193/375 - (51%) Gaps:57/375 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 ANAKKRPGVYGPNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDH-KTHEHVAL 304
            ::.:||      :.|..|:|:|..|....|.:..|||::..:|:|:||:|::..|| ....|||:
Human   130 SHRRKR------SRSIEDDEEGHLICQSGDVLRARYEIVDTLGEGAFGKVVECIDHGMDGMHVAV 188

  Fly   305 KIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKN 369
            |||:|..|:...|:.||::|.||...|..:....:.|.::|....|.||.||||.::.|:.||:|
Human   189 KIVKNVGRYREAARSEIQVLEHLNSTDPNSVFRCVQMLEWFDHHGHVCIVFELLGLSTYDFIKEN 253

  Fly   370 GFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVL-------------LKQQGR----SG 417
            .|..|.:..:|:.|:.:.|.::.|:.|.:.|.|:||||:|             :|:..|    :.
Human   254 SFLPFQIDHIRQMAYQICQSINFLHHNKLTHTDLKPENILFVKSDYVVKYNSKMKRDERTLKNTD 318

  Fly   418 IKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGENES 482
            |||:||||:.::::...|.:.:|.||||||||...:.:..|:||:||||.|...|..:|...:..
Human   319 IKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFQTHDSK 383

  Fly   483 DQLACIIEVLGMPNKNILASSKRSKSF---------FSPKGYPRYCTVRTMSDGMVVLIGGQSRR 538
            :.||.:..:||...::::..:::.|.|         .|..|  ||.                   
Human   384 EHLAMMERILGPIPQHMIQKTRKRKYFHHNQLDWDEHSSAG--RYV------------------- 427

  Fly   539 GKQRGPPCSKSLSKALDGCKDPLFLNFIRGCLEWDADKRLTPSEALKHPW 588
             ::|..|. |......|...:.|| :.:|..||:|..:|:|..|||:||:
Human   428 -RRRCKPL-KEFMLCHDEEHEKLF-DLVRRMLEYDPTQRITLDEALQHPF 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk3NP_001033810.1 PKc_DYRK2_3 211..589 CDD:271126 116/375 (31%)
S_TKc 276..589 CDD:214567 107/340 (31%)
CLK4NP_065717.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..143 4/18 (22%)
PKc_CLK1_4 146..475 CDD:271115 110/353 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.