DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk3 and clk2

DIOPT Version :9

Sequence 1:NP_001033810.1 Gene:Dyrk3 / 3885567 FlyBaseID:FBgn0027101 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_031746276.1 Gene:clk2 / 496828 XenbaseID:XB-GENE-922501 Length:503 Species:Xenopus tropicalis


Alignment Length:387 Identity:110/387 - (28%)
Similarity:187/387 - (48%) Gaps:70/387 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 KKRPGVYGPNNSE-----------YDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHK 297
            |:|...|..::|.           .|:.:|..|:...|.:..|||::..:|:|:||:|::..||:
 Frog   124 KRRTRSYSQSSSRSRQSSRRAKSVEDDVEGHLIYHSGDWLQERYEIVSTLGEGTFGRVVQCVDHR 188

  Fly   298 T-HEHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSIN 361
            . ...|||||::|.:::...|:.||.:|..:...|..|....:.|:|:|.:..|.||:||||.::
 Frog   189 RGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPENKHLCVQMYDWFDYHGHMCISFELLGLS 253

  Fly   362 LYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLL-------------KQQ 413
            .::.:|:|.:..:.:..||..|..:.|.:..|:.|.:.|.|:||||:|.             |:.
 Frog   254 TFDFLKENNYFPYPIHQVRHMALQVCQAVKFLHDNKLTHTDLKPENILFVSSDYELTYNMEKKRD 318

  Fly   414 GR----SGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHA 474
            .|    :.|:|:||||:.|:::...|.:.:|.||||||||...:.:..|:||:|||:.|...|..
 Frog   319 ERCVKNTDIRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWNQPCDVWSVGCIIFEYYVGFT 383

  Fly   475 LFPGENESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRG 539
            ||...:..:.||.:..:||.....::..:::.|.|:    :.|.......|.|..|         
 Frog   384 LFQTHDNREHLAMMERILGPVPSRMVRKTRKQKYFY----HGRLDWDDNTSAGRYV--------- 435

  Fly   540 KQRGPPCSKSLSKALDGCKDPL-------------FLNFIRGCLEWDADKRLTPSEALKHPW 588
                          .:.|| ||             ..:.|.|.||::..||:|.:.|||||:
 Frog   436 --------------RENCK-PLRRYMMMETEEHHQLFSLIEGMLEYEPSKRMTLAAALKHPF 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk3NP_001033810.1 PKc_DYRK2_3 211..589 CDD:271126 110/387 (28%)
S_TKc 276..589 CDD:214567 101/344 (29%)
clk2XP_031746276.1 PKc_CLK2 154..483 CDD:271117 104/357 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.