DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk3 and Clk2

DIOPT Version :9

Sequence 1:NP_001033810.1 Gene:Dyrk3 / 3885567 FlyBaseID:FBgn0027101 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_008759408.1 Gene:Clk2 / 365842 RGDID:1359711 Length:540 Species:Rattus norvegicus


Alignment Length:384 Identity:116/384 - (30%)
Similarity:198/384 - (51%) Gaps:44/384 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 KKRPGVYGPNNSEY---------DNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKT- 298
            ::|...:..::|::         |:.:|..|:...|.:..|||::..:|:|:||:|::..||:. 
  Rat   162 RRRSRTFSHSSSQHSSRRAKSVEDDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRG 226

  Fly   299 HEHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLY 363
            ...|||||::|.:::...|:.||.:|..:...|..|....:.|||:|.:..|.||:||||.::.:
  Rat   227 GARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTF 291

  Fly   364 ELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLL-------------KQQGR 415
            :.:|.|.:..:.:..||..|..|.|.:..|:.|.:.|.|:||||:|.             |:..|
  Rat   292 DFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDER 356

  Fly   416 S----GIKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALF 476
            |    .::|:||||:.|:::...|.:.:|.||||||||...:.:..|:||:|||:.|...|..||
  Rat   357 SVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYYVGFTLF 421

  Fly   477 PGENESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRGKQ 541
            ...:..:.||.:..:||.....::..:::.|.|:  :|  |.......|.|..|         ::
  Rat   422 QTHDNREHLAMMERILGPVPSRMIRKTRKQKYFY--RG--RLDWDENTSAGRYV---------RE 473

  Fly   542 RGPPCSKSL-SKALDGCKDPLFLNFIRGCLEWDADKRLTPSEALKHPWLRRRLPRPPSS 599
            ...|..:.| |:|.|  ...|| :.|...||::..||||..|||:||:.......||::
  Rat   474 NCKPLRRYLTSEAED--HHQLF-DLIENMLEYEPAKRLTLGEALQHPFFACLRTEPPNT 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk3NP_001033810.1 PKc_DYRK2_3 211..589 CDD:271126 114/372 (31%)
S_TKc 276..589 CDD:214567 107/331 (32%)
Clk2XP_008759408.1 PKc_CLK2 190..519 CDD:271117 110/344 (32%)
S_TKc 203..519 CDD:214567 107/331 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.