DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk3 and clk4a

DIOPT Version :9

Sequence 1:NP_001033810.1 Gene:Dyrk3 / 3885567 FlyBaseID:FBgn0027101 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_003199888.1 Gene:clk4a / 321857 ZFINID:ZDB-GENE-030131-576 Length:496 Species:Danio rerio


Alignment Length:366 Identity:113/366 - (30%)
Similarity:195/366 - (53%) Gaps:39/366 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 ANAKKRPGVYGPNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDH-KTHEHVAL 304
            ::.:||      :.|..|:|:|..::...|.:..|||::..:|:|:||:|::..|| |....:||
Zfish   143 SHRRKR------SRSVEDDEEGHLVYHSGDMLRARYEIVCTLGEGAFGKVVECIDHEKVGARIAL 201

  Fly   305 KIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKN 369
            ||::|.:|:...|..|:.:|..:...|.......:.|:|:|....|.||.||||.::.|:.:|:|
Zfish   202 KIIKNIERYRDAALSEVEVLEQINSLDCDRRYACVRMYDWFDHHGHICIAFELLGLSTYDFLKEN 266

  Fly   370 GFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVL-------------LKQQGRS----G 417
            .|:.|.:..:|..|:.:::.:..|:||.:.|.|:||||:|             :|:..|:    .
Zfish   267 NFQPFYINHIRHMAYQIIRAVRFLHKNKLTHTDLKPENILFVNSEYNIRYNSKMKRDERTVKNPD 331

  Fly   418 IKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGENES 482
            :||:|||::.:|::...:.:.:|.||||||||...:..:.|:||:||||.|...|..||...:..
Zfish   332 VKVVDFGNATYEHEHHTSVVSTRHYRAPEVILDLGWSHSCDVWSVGCILIEYYLGSTLFQTHDSK 396

  Fly   483 DQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRGKQRGPPCS 547
            :.||.:..|||....::|..:::|:...:.|           .|..:....|:..| ||..|...
Zfish   397 EHLAMMERVLGPIPTHMLQKTRKSRFVRNDK-----------LDWDIHSSSGRYVR-KQCKPLRQ 449

  Fly   548 KSLSKALDGCKDPLFLNFIRGCLEWDADKRLTPSEALKHPW 588
            ..:|.:.|  .:.|| :.|...||:|..||:|..||:|||:
Zfish   450 YLVSSSSD--HEQLF-DLIERMLEYDVTKRITLDEAIKHPF 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk3NP_001033810.1 PKc_DYRK2_3 211..589 CDD:271126 113/366 (31%)
S_TKc 276..589 CDD:214567 105/331 (32%)
clk4aXP_003199888.1 PKc_like 159..488 CDD:304357 107/344 (31%)
S_TKc 172..488 CDD:214567 105/331 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.