DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk3 and Clk1

DIOPT Version :9

Sequence 1:NP_001033810.1 Gene:Dyrk3 / 3885567 FlyBaseID:FBgn0027101 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_001100383.2 Gene:Clk1 / 301434 RGDID:1311469 Length:483 Species:Rattus norvegicus


Alignment Length:366 Identity:126/366 - (34%)
Similarity:201/366 - (54%) Gaps:39/366 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 ANAKKRPGVYGPNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKT-HEHVAL 304
            ::.:||      :.|..|:|:|..|....|.::.|||::..:|:|:||:|::..|||. ..|||:
  Rat   131 SHRRKR------SRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECIDHKVGGRHVAV 189

  Fly   305 KIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKN 369
            |||:|..|:...||.||::|.||...|.::|...:.|.::|..|.|.||.||||.::.|:.||:|
  Rat   190 KIVKNVDRYCEAAQSEIQVLEHLNATDPHSTFRCVQMLEWFEHRGHICIVFELLGLSTYDFIKEN 254

  Fly   370 GFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVL-------------LKQQGRS----G 417
            .|..|.:..:||.|:.:.:.::.|:.|.:.|.|:||||:|             :|:..|:    .
  Rat   255 SFLPFRMDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVKSDYTEAYNPKMKRDERTIVNPD 319

  Fly   418 IKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGENES 482
            |||:||||:.::::...|.:.:|.||||||||...:.:..|:||:||||.|...|..:||..:..
  Rat   320 IKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSR 384

  Fly   483 DQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRGKQRGPPCS 547
            :.||.:..:||...|:::..: |.:::|.   :.|.......|.|..|     |||.|   |...
  Rat   385 EHLAMMERILGPLPKHMIEKT-RKRTYFH---HDRLDWDEHSSAGRYV-----SRRCK---PLKE 437

  Fly   548 KSLSKALDGCKDPLFLNFIRGCLEWDADKRLTPSEALKHPW 588
            ..||:   ..:..|..:.|...||:|..||:|..||||||:
  Rat   438 FMLSQ---DAEHELLFDLIGKMLEYDPAKRITLKEALKHPF 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk3NP_001033810.1 PKc_DYRK2_3 211..589 CDD:271126 126/366 (34%)
S_TKc 276..589 CDD:214567 117/331 (35%)
Clk1NP_001100383.2 PKc_CLK1_4 147..476 CDD:271115 120/344 (35%)
S_TKc 160..476 CDD:214567 117/331 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.