DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk3 and Prpf4b

DIOPT Version :9

Sequence 1:NP_001033810.1 Gene:Dyrk3 / 3885567 FlyBaseID:FBgn0027101 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_001011923.1 Gene:Prpf4b / 291078 RGDID:1307784 Length:1007 Species:Rattus norvegicus


Alignment Length:546 Identity:143/546 - (26%)
Similarity:238/546 - (43%) Gaps:117/546 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 QYLTRCFEPLAMLNDSKEDFPTQPSNNIANYPGDIQILPIFDCCEISESIQAISLPNVTSPSKTK 145
            |.:.:.::.||  .||....|::||:                             |..::.|::.
  Rat   546 QAIVQKYKYLA--EDSNISVPSEPSS-----------------------------PQSSTRSRSP 579

  Fly   146 DVPGLFLRTISENSKSKSEPECESLISVKESSVMENHTFLFHEQIIMSGQQKCELHEKPKVLVVS 210
            . |...|..::.:.|   |.|.|: :...|:||...|..:..||...|.|:|.            
  Rat   580 S-PDDILERVAADVK---EYEREN-VDTFEASVKAKHNLMTVEQNNGSSQKKL------------ 627

  Fly   211 PQQVMILYMNKLTPYERTEILTYPQIYF---------IGANAKKRPGVYGPNNSEYDNEQGAYIH 266
                       |.|...||.......||         ||.:.|:.|.:    ...:.:.:|.|..
  Rat   628 -----------LAPDMFTESDDMFAAYFDSARLRAAGIGKDFKENPNL----RDNWTDAEGYYRV 677

  Fly   267 VPHDHVAYRYEMLKIIGKGSFGQVIKAYDH-KTHEHVALKIVRNEKRFHRQAQEEIRILHHLRRH 330
            ...:.:..||.:....|:|.|..|::|.|: :.::.||:||:||.:...:...:|:..|..|...
  Rat   678 NIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDA 742

  Fly   331 DKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFK-GFSLQLVRKFAHSLLQCLDALY 394
            |..:..:.:.:|.:|..:.|.|:.||.||:||.|::||.|.. |..::.||.::..|...|..|.
  Rat   743 DPDDKFHCLRLFRHFYHKQHLCLVFEPLSMNLREVLKKYGKDVGLHIKAVRSYSQQLFLALKLLK 807

  Fly   395 KNDIIHCDMKPENVLLKQQGRSGIKVIDFGS-SCFENQRIYTYIQSRFYRAPEVILGGKYGRAID 458
            :.:|:|.|:||:|:|: .:.::.:|:.|||| |...:..|..|:.||||||||:|:|..|...||
  Rat   808 RCNILHADIKPDNILV-NESKTILKLCDFGSASHVADNDITPYLVSRFYRAPEIIIGKSYDYGID 871

  Fly   459 MWSLGCILAELLSGHALFPGENESDQLACIIEVLG-MPNKNILASSKRSKSFFSPKGYPR----- 517
            |||:||.|.||.:|..||||:..:..|...:::.| ||||.|      .|..|..:.:.:     
  Rat   872 MWSVGCTLYELYTGKILFPGKTNNHMLKLAMDLKGKMPNKMI------RKGVFKDQHFDQNLNFM 930

  Fly   518 ---------------YCTVRTMSDGMVVLIGGQSRRGKQRGPPCSKSLSKALDGCKDPLFLNFIR 567
                           ..|:....|.:..|||.|.....||         |.:...||     .:.
  Rat   931 YIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQR---------KKVHQLKD-----LLD 981

  Fly   568 GCLEWDADKRLTPSEALKHPWLRRRL 593
            ..|..|..||::.::||:|.:::.::
  Rat   982 QILMLDPAKRISINQALQHAFIQEKI 1007

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk3NP_001033810.1 PKc_DYRK2_3 211..589 CDD:271126 118/410 (29%)
S_TKc 276..589 CDD:214567 105/336 (31%)
Prpf4bNP_001011923.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..535
PTZ00108 <171..396 CDD:240271
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 560..583 6/52 (12%)
STKc_PRP4 686..1003 CDD:271037 106/337 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.