DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk3 and Clk3

DIOPT Version :9

Sequence 1:NP_001033810.1 Gene:Dyrk3 / 3885567 FlyBaseID:FBgn0027101 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_006243208.1 Gene:Clk3 / 171305 RGDID:621259 Length:640 Species:Rattus norvegicus


Alignment Length:394 Identity:120/394 - (30%)
Similarity:193/394 - (48%) Gaps:43/394 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 ANAKKRPGVYGPNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDH-KTHEHVAL 304
            |:::.:......:.|..|:::|..:....|.:..|||::..:|:|:||:|::..|| :....|||
  Rat   271 ASSRSQQSSKRSSRSVEDDKEGHLVCRIGDWLQERYEIVGNLGEGTFGKVVECLDHARGKSQVAL 335

  Fly   305 KIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKN 369
            ||:||..::...|:.||.:|..::..||.|....:.|.|:|.|..|.||.||||..|.:|.:|:|
  Rat   336 KIIRNVGKYREAARLEINVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKEN 400

  Fly   370 GFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLL-----------------KQQGRSG 417
            .|:.:.|..||..|:.|...|..|::|.:.|.|:||||:|.                 |....:.
  Rat   401 NFQPYPLPHVRHMAYQLCHALRFLHENQLTHTDLKPENILFVNSEFETLYNEHKSCEEKSVKNTS 465

  Fly   418 IKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGENES 482
            |:|.||||:.|:::...|.:.:|.||.|||||...:.:..|:||:||||.|...|..||......
  Rat   466 IRVADFGSATFDHEHHTTIVATRHYRPPEVILELGWAQPCDVWSIGCILFEYYRGFTLFQTHENR 530

  Fly   483 DQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRGKQRGPPCS 547
            :.|..:.::||....:::..:::.|.|:  ||  ........|||..|         |:...|..
  Rat   531 EHLVMMEKILGPIPSHMIHRTRKQKYFY--KG--GLVWDENSSDGRYV---------KENCKPLK 582

  Fly   548 KSLSKALDGCKDPLFLNFIRGCLEWDADKRLTPSEALKHPWLRRRLPRPPSSSSGCGGVSGLCSS 612
            ..:.:  |..:.....:.:|..||:|..:|:|.:|||.||:.....|...|          ..||
  Rat   583 SYMLQ--DSLEHVQLFDLMRRMLEFDPAQRITLAEALLHPFFAGLTPEERS----------FHSS 635

  Fly   613 RNES 616
            ||.|
  Rat   636 RNPS 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk3NP_001033810.1 PKc_DYRK2_3 211..589 CDD:271126 113/365 (31%)
S_TKc 276..589 CDD:214567 107/330 (32%)
Clk3XP_006243208.1 PHA03247 29..>162 CDD:223021
PKc_CLK3 292..622 CDD:271116 110/344 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.