DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk3 and Clk2

DIOPT Version :9

Sequence 1:NP_001033810.1 Gene:Dyrk3 / 3885567 FlyBaseID:FBgn0027101 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_031738.2 Gene:Clk2 / 12748 MGIID:1098669 Length:499 Species:Mus musculus


Alignment Length:361 Identity:114/361 - (31%)
Similarity:189/361 - (52%) Gaps:35/361 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 DNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKT-HEHVALKIVRNEKRFHRQAQEEI 321
            |:.:|..|:...|.:..|||::..:|:|:||:|::..||:. ...|||||::|.:::...|:.||
Mouse   144 DDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRGGTQVALKIIKNVEKYKEAARLEI 208

  Fly   322 RILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAHSL 386
            .:|..:...|..|....:.|||:|.:..|.||:||||.::.::.:|.|.:..:.:..||..|..|
Mouse   209 NVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQL 273

  Fly   387 LQCLDALYKNDIIHCDMKPENVLL-------------KQQGRS----GIKVIDFGSSCFENQRIY 434
            .|.:..|:.|.:.|.|:||||:|.             |:..||    .::|:||||:.|:::...
Mouse   274 CQAVKFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHS 338

  Fly   435 TYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKNI 499
            |.:.:|.||||||||...:.:..|:||:|||:.|...|..||...:..:.||.:..:||.....:
Mouse   339 TIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPVPSRM 403

  Fly   500 LASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRGKQRGPPCSKSL-SKALDGCKDPLFL 563
            :..:::.|.|:  :|  |.......|.|..|         ::...|..:.| |:|.|  ...|| 
Mouse   404 IRKTRKQKYFY--RG--RLDWDENTSAGRYV---------RENCKPLRRYLTSEAED--HHQLF- 452

  Fly   564 NFIRGCLEWDADKRLTPSEALKHPWLRRRLPRPPSS 599
            :.|...||::..||||..|||:||:.......||::
Mouse   453 DLIENMLEYEPAKRLTLGEALQHPFFACLRTEPPNT 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk3NP_001033810.1 PKc_DYRK2_3 211..589 CDD:271126 112/349 (32%)
S_TKc 276..589 CDD:214567 107/331 (32%)
Clk2NP_031738.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..65
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..142
PKc_CLK2 149..478 CDD:271117 110/344 (32%)
S_TKc 162..478 CDD:214567 107/331 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.