DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk3 and Clk3

DIOPT Version :9

Sequence 1:NP_001033810.1 Gene:Dyrk3 / 3885567 FlyBaseID:FBgn0027101 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_036010394.1 Gene:Clk3 / 102414 MGIID:1098670 Length:507 Species:Mus musculus


Alignment Length:394 Identity:120/394 - (30%)
Similarity:193/394 - (48%) Gaps:43/394 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 ANAKKRPGVYGPNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDH-KTHEHVAL 304
            |:::.:......:.|..|:::|..:....|.:..|||::..:|:|:||:|::..|| :....|||
Mouse   138 ASSRSQQSSKRSSRSVEDDKEGHLVCRIGDWLQERYEIVGNLGEGTFGKVVECLDHARGKSQVAL 202

  Fly   305 KIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKN 369
            ||:||..::...|:.||.:|..::..||.|....:.|.|:|.|..|.||.||||..|.:|.:|:|
Mouse   203 KIIRNVGKYREAARLEINVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKEN 267

  Fly   370 GFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLL-----------------KQQGRSG 417
            .|:.:.|..||..|:.|...|..|::|.:.|.|:||||:|.                 |....:.
Mouse   268 NFQPYPLPHVRHMAYQLCHALRFLHENQLTHTDLKPENILFVNSEFETLYNEHKSCEEKSVKNTS 332

  Fly   418 IKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGENES 482
            |:|.||||:.|:::...|.:.:|.||.|||||...:.:..|:||:||||.|...|..||......
Mouse   333 IRVADFGSATFDHEHHTTIVATRHYRPPEVILELGWAQPCDVWSIGCILFEYYRGFTLFQTHENR 397

  Fly   483 DQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRGKQRGPPCS 547
            :.|..:.::||....:::..:::.|.|:  ||  ........|||..|         |:...|..
Mouse   398 EHLVMMEKILGPIPSHMIHRTRKQKYFY--KG--GLVWDENSSDGRYV---------KENCKPLK 449

  Fly   548 KSLSKALDGCKDPLFLNFIRGCLEWDADKRLTPSEALKHPWLRRRLPRPPSSSSGCGGVSGLCSS 612
            ..:.:  |..:.....:.:|..||:|..:|:|.:|||.||:.....|...|          ..||
Mouse   450 SYMLQ--DSLEHVQLFDLMRRMLEFDPAQRITLAEALLHPFFAGLTPEERS----------FHSS 502

  Fly   613 RNES 616
            ||.|
Mouse   503 RNPS 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk3NP_001033810.1 PKc_DYRK2_3 211..589 CDD:271126 113/365 (31%)
S_TKc 276..589 CDD:214567 107/330 (32%)
Clk3XP_036010394.1 PKc_CLK3 159..489 CDD:271116 110/344 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.