DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and MSS4

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_010494.1 Gene:MSS4 / 851789 SGDID:S000002616 Length:779 Species:Saccharomyces cerevisiae


Alignment Length:453 Identity:132/453 - (29%)
Similarity:216/453 - (47%) Gaps:84/453 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KISSSSQPRILKKK----HFRVKHQKVKLFRANEPILSV----------------FMWGINHTIN 48
            |.|.|:...|.|.:    |.|...:|.|.|..::..:.:                .:.||...::
Yeast   337 KRSESATAEIKKMRQSLLHKREMKRKRKTFLVDDDRVLIGNKVSEGHVNFIIAYNMLTGIRVAVS 401

  Fly    49 ELSHVNIPVMLLPDDFRAYSKIKVDNHLFNKENMPSH---FKVKEYCPLVFRNLRERFGVDDVDY 110
            ..|.:..|  |.|.|||...|:..|.|  ..|..||.   ||.|:|||.|||.||..||:|..||
Yeast   402 RCSGIMKP--LTPADFRFTKKLAFDYH--GNELTPSSQYAFKFKDYCPEVFRELRALFGLDPADY 462

  Fly   111 RESLTRSQPI-QIDSSGKSGAQFYQSYDKFFIIKSLTSEEIERMHAFLKQYHPYVVERHGKTLLP 174
            ..|||....: :::|.||||:.||.|.|..:|||::...|...:...:::|:.:|.: :..||:.
Yeast   463 LVSLTSKYILSELNSPGKSGSFFYYSRDYKYIIKTIHHSEHIHLRKHIQEYYNHVRD-NPNTLIC 526

  Fly   175 QYLGMYRI--------TVESVQYYFVVMRNVFSSHLTIHKKFDLKGST------VDREASEKELE 225
            |:.|::|:        .::..:.||:||.|:|..||.||..:||||||      :|:|...|: .
Yeast   527 QFYGLHRVKMPISFQNKIKHRKIYFLVMNNLFPPHLDIHITYDLKGSTWGRFTNLDKERLAKD-R 590

  Fly   226 KNLPTFKDNDFIKQKVKLDIGKEAKDKLMDTLSNDVDLLTKLHIMDYSLLVGVHDCVRAEEEALQ 290
            ...|..||.:::::..|:..|...|...:..|..||:||.||:.||||||:|:||..:|:|:.||
Yeast   591 SYRPVMKDLNWLEEGQKIKFGPLKKKTFLTQLKKDVELLAKLNTMDYSLLIGIHDINKAKEDDLQ 655

  Fly   291 GDNILTVGRSENSES--------------EECDSGERWTYNTPPDSPRGAQYKEVVYEVDIYDIP 341
            ..:..::.....::.              .|.:.|.|          ...|:..   :||:    
Yeast   656 LADTASIEEQPQTQGPIRTGTGTVVRHFFREFEGGIR----------ASDQFNN---DVDL---- 703

  Fly   342 SIEEKREIYFIAIIDVLTQYGVKKQAAKAAKTVKYGSNVDGISTCDPEQYAKRFLDFMDKAIE 404
                   ||::.|||.||.|.|.|:.....:::::.:.:  :|...|..||.||.:|::.:::
Yeast   704 -------IYYVGIIDFLTNYSVMKKLETFWRSLRHDTKL--VSAIPPRDYANRFYEFIEDSVD 757

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 122/418 (29%)
MSS4NP_010494.1 MSS4 4..772 CDD:227578 132/453 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001219
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23086
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2198
SonicParanoid 1 1.000 - - X950
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.