DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and FAB1

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_116674.2 Gene:FAB1 / 850574 SGDID:S000001915 Length:2278 Species:Saccharomyces cerevisiae


Alignment Length:346 Identity:87/346 - (25%)
Similarity:136/346 - (39%) Gaps:119/346 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 HFKV-KEYCPLVFRNLRERFGVDDVDYRESLTRSQPIQIDSS-GKSGAQFYQSYDKFFIIKSLTS 147
            ||.| ::.|     :.:|.|       .:||:|.  ::.||: ||||:.|.::.|..||||.|:.
Yeast  2013 HFDVFRKIC-----DCQENF-------IQSLSRC--VKWDSNGGKSGSGFLKTLDDRFIIKELSH 2063

  Fly   148 EEIERMHAFLKQYHPYVVER--HG-KTLLPQYLGMYRITV-------ESVQYYFVVMRNVFSSHL 202
            .|:|....|...|..|:.:.  |. .|.|.:..|.|:|.|       :|.:...::|.|:|....
Yeast  2064 AELEAFIKFAPSYFEYMAQAMFHDLPTTLAKVFGFYQIQVKSSISSSKSYKMDVIIMENLFYEKK 2128

  Fly   203 TIHKKFDLKGSTVDR------EASEKELEKNLPTFKDNDFIKQKVKLDIGKEAKDKLMDTLSNDV 261
            |. :.||||||..:|      :|:|..|::|:.     ::|.:. .:.:.:..|..|..::.||.
Yeast  2129 TT-RIFDLKGSMRNRHVEQTGKANEVLLDENMV-----EYIYES-PIHVREYDKKLLRASVWNDT 2186

  Fly   262 DLLTKLHIMDYSLLVGVHDCVRAEEEALQGDN---ILTVGRSENSESEECDSGERWTYNTPPDSP 323
            ..|.|:::|||||::|:             ||   .||||                         
Yeast  2187 LFLAKMNVMDYSLVIGI-------------DNEGYTLTVG------------------------- 2213

  Fly   324 RGAQYKEVVYEVDIYDIPSIEEKREIYFIAIIDVLTQYGVKKQAAKAAKTVKYGSNVDGIS---- 384
                                          |||.:..:...|   |....||....|.|.|    
Yeast  2214 ------------------------------IIDFIRTFTWDK---KLESWVKEKGLVGGASVIKQ 2245

  Fly   385 --TCDPEQYAKRFLDFMDKAI 403
              ...|.||.|||.:.|::.|
Yeast  2246 PTVVTPRQYKKRFREAMERYI 2266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 86/344 (25%)
FAB1NP_116674.2 PHA03255 <64..>145 CDD:165513
FYVE_like_SF 236..296 CDD:333710
Fab1_TCP 797..1056 CDD:239450
MSS4 1597..2278 CDD:227578 87/346 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.