DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and PIP5K2

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001319397.1 Gene:PIP5K2 / 844110 AraportID:AT1G77740 Length:754 Species:Arabidopsis thaliana


Alignment Length:413 Identity:118/413 - (28%)
Similarity:185/413 - (44%) Gaps:83/413 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GINHTINELSHVNIPVMLLPDDFRAYSKIKVDNHLFNKENMPSH----FKVKEYCPLVFRNLRER 102
            ||.:::.:  |.::...|...||....|..........:..|.|    |:.|:|||||||.|||.
plant   366 GIRYSVGK--HASVVRDLKQSDFDPSEKFWTRFPPEGSKTTPPHLSVDFRWKDYCPLVFRRLREL 428

  Fly   103 FGVDDVDYRESLTRSQPI-QIDSSGKSGAQFYQSYDKFFIIKSLTSEEIERMHAFLKQYHPYVVE 166
            |.||..||..::..:..: ::.|.||||:.||.:.|..|:||::...|::.:...|..|:.:|.:
plant   429 FTVDPADYMLAICGNDALRELSSPGKSGSFFYLTQDDRFMIKTVKKSEVKVLLRMLPSYYKHVCQ 493

  Fly   167 RHGKTLLPQYLGMYRI-TVESVQYYFVVMRNVFSSHLTIHKKFDLKGSTVDREASEKELE-KNLP 229
             :..||:.::.|::.| .|...:..|:||.|:|.|...|.::||||||:..|..|:.|.| ....
plant   494 -YENTLVTRFYGVHCIKPVGGQKTRFIVMGNLFCSEYRIQRRFDLKGSSHGRYTSKPEGEIDETT 557

  Fly   230 TFKDNDFIKQKVKLDIGKEAKDKLMDTLSNDVDLLTKLHIMDYSLLVGVHDCVRAEEEALQGDN- 293
            |.||.|.   .....:.:....:||..:..|.:.|....|||||||||||         .:.|| 
plant   558 TLKDLDL---NFAFRLQRNWYQELMTQIKRDCEFLEAERIMDYSLLVGVH---------FRDDNT 610

  Fly   294 ---------ILTVGRSENSESEECDSGERWT---------------------YNTPPDSPR---- 324
                     :|..|:.|:.:||:...|.|:.                     .|.|..:.|    
plant   611 GDKMGLSPFVLRSGKIESYQSEKFMRGCRFLEAELQDMDRILAGRKPLIRLGANMPARAERMARR 675

  Fly   325 ---------GAQYKE--VVYEVDIYDIPSIEEKREIYFIAIIDVLTQYGVKKQAAKAAKTVKYGS 378
                     |..|:.  .||||.:|             ..|||:|..|.:.|:...|.|:::  :
plant   676 SDYDQYSSGGTNYQSHGEVYEVVLY-------------FGIIDILQDYDISKKIEHAYKSLQ--A 725

  Fly   379 NVDGISTCDPEQYAKRFLDFMDK 401
            :...||..||:.|::||.||:.:
plant   726 DPASISAVDPKLYSRRFRDFISR 748

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 118/413 (29%)
PIP5K2NP_001319397.1 PLN03185 73..750 CDD:215619 118/413 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23086
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.