DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and PIP4K2B

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_011523628.1 Gene:PIP4K2B / 8396 HGNCID:8998 Length:443 Species:Homo sapiens


Alignment Length:430 Identity:232/430 - (53%)
Similarity:297/430 - (69%) Gaps:52/430 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KKKHFRVKHQKVKLFRANEPILSVFMWGINHTINELSHVNIPVMLLPDDFRAYSKIKVDNHLFNK 79
            |||||..  ||||||||:||||||.|||:||||||||:|.:||||:||||:||||||||||||||
Human    24 KKKHFVC--QKVKLFRASEPILSVLMWGVNHTINELSNVPVPVMLMPDDFKAYSKIKVDNHLFNK 86

  Fly    80 ENMPSHFKVKEYCPLVFRNLRERFGVDDVDYRESLTRSQPIQIDSSGKSGAQFYQSYDKFFIIKS 144
            ||:||.||.|||||:||||||||||:||.||:.|:|||.||..||.|:.|.:|..:||:.|:||:
Human    87 ENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNSVTRSAPINSDSQGRCGTRFLTTYDRRFVIKT 151

  Fly   145 LTSEEIERMHAFLKQYH---------------------------PYVVERHGKTLLPQYLGMYRI 182
            ::||::..||..||:||                           .::||.||.|||||:|||||:
Human   152 VSSEDVAEMHNILKKYHQMAGSLACLCILSLPCGIPISGWQKRCKFIVECHGNTLLPQFLGMYRL 216

  Fly   183 TVESVQYYFVVMRNVFSSHLTIHKKFDLKGSTVDREASEKELEKNLPTFKDNDFIKQKVKLDIGK 247
            ||:.|:.|.||.|||||..||:|:|:|||||||.||||:||..|:|||||||||:.:..||.:|:
Human   217 TVDGVETYMVVTRNVFSHRLTVHRKYDLKGSTVAREASDKEKAKDLPTFKDNDFLNEGQKLHVGE 281

  Fly   248 EAKDKLMDTLSNDVDLLTKLHIMDYSLLVGVHDCVRAEEEALQGDNILTVGRSENSESEECDS-- 310
            |:|...::.|..||:.|.:|.|||||||||:||..|||:|.::.:        |.:|.|||::  
Human   282 ESKKNFLEKLKRDVEFLAQLKIMDYSLLVGIHDVDRAEQEEMEVE--------ERAEDEECENDG 338

  Fly   311 ---GERWTYNTPPDS-------PRGAQYKEVVYEVDIYDIPSIEE--KREIYFIAIIDVLTQYGV 363
               ....:|.|||||       ||.....|....||:|.:.|.|.  |:|:||:||||:||.|..
Human   339 VGGNLLCSYGTPPDSPGNLLSFPRFFGPGEFDPSVDVYAMKSHESSPKKEVYFMAIIDILTPYDT 403

  Fly   364 KKQAAKAAKTVKYGSNVDGISTCDPEQYAKRFLDFMDKAI 403
            ||:||.||||||:|:..: |||.:||||:|||.:||...:
Human   404 KKKAAHAAKTVKHGAGAE-ISTVNPEQYSKRFNEFMSNIL 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 219/411 (53%)
PIP4K2BXP_011523628.1 PIPKc 39..443 CDD:238081 219/413 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 281 1.000 Domainoid score I1678
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2634
Inparanoid 1 1.050 455 1.000 Inparanoid score I1592
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52363
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 1 1.000 - - FOG0001219
OrthoInspector 1 1.000 - - otm41537
orthoMCL 1 0.900 - - OOG6_104901
Panther 1 1.100 - - LDO PTHR23086
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2198
SonicParanoid 1 1.000 - - X950
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.