DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and PIP5K1B

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001362965.1 Gene:PIP5K1B / 8395 HGNCID:8995 Length:540 Species:Homo sapiens


Alignment Length:424 Identity:127/424 - (29%)
Similarity:188/424 - (44%) Gaps:84/424 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KHQKVKLFR--ANEPILSVFMWGINHTINELSHVNIPVM-LLPDDFRAYSKIKVDNHLFNKENMP 83
            |..:.|.::  |:..|......||.:|:..|:  :.|.. :|..||.....:.:.:...|.  .|
Human    14 KQNEEKTYKKTASSAIKGAIQLGIGYTVGNLT--SKPERDVLMQDFYVVESVFLPSEGSNL--TP 74

  Fly    84 SH----FKVKEYCPLVFRNLRERFGVDDVDYRESLTRSQPIQIDSSGKSGAQFYQSYDKFFIIKS 144
            :|    |:.|.|.||.||..||.||:...||..|:.....|::.:.|.||:.|:.:.|..||||:
Human    75 AHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNPGASGSLFFVTSDDEFIIKT 139

  Fly   145 LTSEEIERMHAFLKQYHPYVVERHGKTLLPQYLGMYRITVESVQYYFVVMRNVFSSHLTIHKKFD 209
            :..:|.|.:...|..|: ..:.::.:||||::.|:|.:....:....|||.||....:.:|..:|
Human   140 VQHKEAEFLQKLLPGYY-MNLNQNPRTLLPKFYGLYCMQSGGINIRIVVMNNVLPRSMRMHFTYD 203

  Fly   210 LKGSTVDREASEKELEKNLPTFKDNDFIKQKVK-LDIGKEAKDKLMDTLSNDVDLLTKLHIMDYS 273
            |||||..|.||.||.||:.|||||.||::...: |....|..:.||.||..|..:|....|||||
Human   204 LKGSTYKRRASRKEREKSNPTFKDLDFLQDMHEGLYFDTETYNALMKTLQRDCRVLESFKIMDYS 268

  Fly   274 LLVGV----HDCVRAEEEALQ----------------------------GDNILTVGRSENSESE 306
            ||:|:    |.....|||..|                            ||.|:|    ||    
Human   269 LLLGIHFLDHSLKEKEEETPQNVPDAKRTGMQKVLYSTAMESIQGPGKSGDGIIT----EN---- 325

  Fly   307 ECDSGERWTYNTPPDSPRGAQYKEVVYEVDIYDIPSIEEKRE--IYFIAIIDVLTQYGVKKQAAK 369
                         ||:..|              ||:...:.|  :.|:.|||:|..|.:.|:...
Human   326 -------------PDTMGG--------------IPAKSHRGEKLLLFMGIIDILQSYRLMKKLEH 363

  Fly   370 AAKTVKYGSNVDGISTCDPEQYAKRFLDFMDKAI 403
            :.|.:.|..  |.:|...|..||.|||.||:..:
Human   364 SWKALVYDG--DTVSVHRPSFYADRFLKFMNSRV 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 124/410 (30%)
PIP5K1BNP_001362965.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 2/6 (33%)
PIPKc_PIP5K1B 27..400 CDD:340444 124/411 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52363
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.