DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and PIPK10

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001329151.1 Gene:PIPK10 / 828066 AraportID:AT4G01190 Length:411 Species:Arabidopsis thaliana


Alignment Length:376 Identity:101/376 - (26%)
Similarity:161/376 - (42%) Gaps:76/376 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SHFKVKEYCPLVFRNLRERFGVDDVDYRESLTRSQPIQIDSSGKSGAQFYQSYDKFFIIKSLTSE 148
            :.|..|:|||:.|..::|..|:|..||..|:...:.::..||||.|..|:.|.|..|:||.|...
plant    37 TEFDWKDYCPVGFGLIQELEGIDHDDYLLSICTDETLKKISSGKIGNVFHISNDNRFLIKILRKS 101

  Fly   149 EIERMHAFLKQYHPYVVERHGKTLLPQYLGMYRI-TVESVQYYFVVMRNVFSSHLTIHKKFDLKG 212
            ||:.....|.:|:.: :..|..:|..:..|.:.: .:..|:.||.||.|:..|.:.::|.:||||
plant   102 EIKVTLEMLPRYYRH-INYHRSSLFTRIFGAHSVKPLGGVKTYFAVMSNMLHSTIFVNKLYDLKG 165

  Fly   213 STVDREASEKELE-KNLPTFKDNDFIKQKVKLD----IGKEAKDKLMDTLSNDVDLLTKLHIMDY 272
            |...|  |.|::| :|....||.||       |    :...|:.:::.....|.:||.:..||||
plant   166 SPKGR--SNKKIEVRNTTVLKDIDF-------DFCFYVDPLARQRIIKQTKLDCELLEEEGIMDY 221

  Fly   273 SLLVGVH---DCVRAEEEALQGDNILTVGRSENSESEECDSGERWTYNTPPDSPRGAQYK----- 329
            |||||:.   .|    :.:|.|.|.:....:..|..:...:....|.::.||....|.|.     
plant   222 SLLVGLQSKGSC----QGSLDGLNPVYGSFAPPSSFKSNSTKSMKTASSSPDRSSVAMYSCSPDR 282

  Fly   330 ---EVVYEVDIYDIPSIEEKRE------------------------------------------- 348
               |....:.|..:.|.....|                                           
plant   283 DSVENEMSMTIQSVTSNSASSETNILATTLSDLFHNSSNINFGMKIPARARRVTRETGEEEWYNV 347

  Fly   349 IYFIAIIDVLTQYGVKKQAAKAAKTVKYGSNVDGISTCDPEQYAKRFLDFM 399
            :.:|.|:|....||:||:.....|:::|.||  .|||..|:.|:.||.||:
plant   348 VLYIGIVDTFQDYGMKKRIEHCYKSIQYNSN--SISTVHPKIYSSRFQDFV 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 101/376 (27%)
PIPK10NP_001329151.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23086
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.