DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and PIP5K9

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001030666.1 Gene:PIP5K9 / 820151 AraportID:AT3G09920 Length:815 Species:Arabidopsis thaliana


Alignment Length:477 Identity:140/477 - (29%)
Similarity:221/477 - (46%) Gaps:116/477 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SSQPRILKKKHFR-VKHQK------VKLFRANEPILSVFMWGINHTINELSHVNIPV-------- 57
            |...|..|:||.| ||..|      :|..|:.:.:||:.: ||.:|:.:::    |:        
plant   364 SRTSRRAKRKHKRLVKEAKKPGEVVIKGHRSYDLMLSLQL-GIRYTVGKIT----PIQRRQVRTA 423

  Fly    58 ---------MLLPDDFRAYSKIKVDNHLFNKENMPSHFKVKEYCPLVFRNLRERFGVDDVDYRES 113
                     |..|   ||.|.:...:|       ...||.|:|||:|||||||.|.:|..||..|
plant   424 DFGPRASFWMTFP---RAGSTMTPPHH-------SEDFKWKDYCPMVFRNLREMFKIDAADYMMS 478

  Fly   114 LTRSQPI-QIDSSGKSGAQFYQSYDKFFIIKSLTSEEIERMHAFLKQYHPYVVERHGKTLLPQYL 177
            :..:..: ::.|.||||:.|:.|.|..|:||:|...|::.:...|..||.: |:.:..||:.::.
plant   479 ICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVKVLLRMLPDYHHH-VKTYENTLITKFF 542

  Fly   178 GMYRITVESVQ-YYFVVMRNVFSSHLTIHKKFDLKGSTVDREASEKELEKNLPTFKDNDFIKQKV 241
            |::||...|.| :.||||.|:|.:.|.||::||||||::.|.|.:.|:::| ...||.|.   ..
plant   543 GLHRIKPSSGQKFRFVVMGNMFFTDLRIHRRFDLKGSSLGRSADKVEIDEN-TILKDLDL---NY 603

  Fly   242 KLDIGKEAKDKLMDTLSNDVDLLTKLHIMDYSLLVGVH---------DCVR------------AE 285
            ...:....::.|:..|..|...|...:|||||||:|||         ..||            ||
plant   604 SFFLETSWREGLLRQLEIDSKFLEAQNIMDYSLLLGVHHRAPQHLRSQLVRSQSITTDALESVAE 668

  Fly   286 EEALQGD------NILTVGR-SENSESEECDSGERWTYNTPPDSPRGAQYKEVVYEVDIY----- 338
            ::.::.|      .::.|.| |||:.:.....|.|...:...|.           |||:.     
plant   669 DDTIEDDMLSYHEGLVLVPRGSENTVTGPHIRGSRLRASAVGDE-----------EVDLLLPGTA 722

  Fly   339 ---------------DIPSIEEKRE---------IYFIAIIDVLTQYGVKKQAAKAAKTVKYGSN 379
                           .||..|:|.:         :.::.|||:|.:|.:.|:...|.|::.:.|.
plant   723 RLQIQQGVNMPARAELIPGREDKEKQILHDCCDVVLYLGIIDILQEYNMTKKIEHAYKSLHFDSL 787

  Fly   380 VDGISTCDPEQYAKRFLDFMDK 401
              .||..||..|::|||:|:.|
plant   788 --SISAVDPTFYSQRFLEFIKK 807

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 129/446 (29%)
PIP5K9NP_001030666.1 PLN03185 48..810 CDD:215619 140/477 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23086
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.