DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and PIP5K6

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_187453.1 Gene:PIP5K6 / 819987 AraportID:AT3G07960 Length:715 Species:Arabidopsis thaliana


Alignment Length:407 Identity:109/407 - (26%)
Similarity:190/407 - (46%) Gaps:50/407 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QKVKLFRANEPILSVFMWGINHTINE---LSHVNIPVMLLPDDFRAYSKIKVDNHLFNKENMPSH 85
            |.:.....|..::.....||.|::..   .:.:::.........:.::|...:...:...:....
plant   320 QTISKGHKNYELMLNLQLGIRHSVGRPAPATSLDLKASAFDPKEKLWTKFPSEGSKYTPPHQSCE 384

  Fly    86 FKVKEYCPLVFRNLRERFGVDDVDYRESLTRSQPI-QIDSSGKSGAQFYQSYDKFFIIKSLTSEE 149
            ||.|:|||:|||.||:.|.||..||..|:..:..: ::.|.||||:.||.:.|..::||::...|
plant   385 FKWKDYCPVVFRTLRKLFSVDAADYMLSICGNDALRELSSPGKSGSFFYLTNDDRYMIKTMKKAE 449

  Fly   150 IERMHAFLKQYHPYVVERHGKTLLPQYLGMYRITVESV---QYYFVVMRNVFSSHLTIHKKFDLK 211
            .:.:...|..|:.: |.....||:.::.|::.:.:...   :..||:|.|:|.:..:||::||||
plant   450 TKVLIRMLPAYYNH-VRACENTLVTKFFGLHCVKLTGTAQKKVRFVIMGNLFCTGHSIHRRFDLK 513

  Fly   212 GSTVDREAS--EKELEKNLPTFKDNDFIKQKVKLDIGKEAKDKLMDTLSNDVDLLTKLHIMDYSL 274
            ||:..|..:  |.|::.| .|.||.|.   .....:.|....:....:..|.:.|.:..||||||
plant   514 GSSHGRLTTKPESEIDPN-TTLKDLDL---NFAFRLQKNWFQEFCRQVDRDCEFLEQERIMDYSL 574

  Fly   275 LVGVHDCVRAEEEALQGDNILTVGR---SENSESE----ECD---------SGERWTYNTPPDSP 323
            |||:|    ..|.|::.....|.|.   :.|||:.    |.|         :..:...|.|....
plant   575 LVGLH----FREAAIKDSATPTSGARTPTGNSETRLSRAEMDRFLLDASKLASIKLGINMPARVE 635

  Fly   324 RGAQYKEVVYEV------DIYDIPSIEEKREIYFIAIIDVLTQYGVKKQAAKAAKTVKYGSNVDG 382
            |.|:..:...::      :.||:        |.:..|||:|..|.:.|:...|.|:::|  :...
plant   636 RTARRSDCENQLVGDPTGEFYDV--------IVYFGIIDILQDYDISKKLEHAYKSMQY--DPTS 690

  Fly   383 ISTCDPEQYAKRFLDFM 399
            ||..||:||::||.||:
plant   691 ISAVDPKQYSRRFRDFI 707

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 108/399 (27%)
PIP5K6NP_187453.1 PLN03185 23..711 CDD:215619 109/407 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23086
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.