DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and PIP5K3

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001324179.1 Gene:PIP5K3 / 817182 AraportID:AT2G26420 Length:719 Species:Arabidopsis thaliana


Alignment Length:436 Identity:117/436 - (26%)
Similarity:216/436 - (49%) Gaps:62/436 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISSSSQPRILKKKHFRVKHQKVKLFRANEPILSVFMWGINHTINELSHVNIPVMLLPDDF----R 65
            :|....||.|.:...:.....|.....|..::.....||.:::.:  |.::...|...||    :
plant   301 MSVQQSPRWLDEGDVKKPGHTVTAGHKNYDLMLNLQLGIRYSVGK--HASLLRELRHSDFDPKDK 363

  Fly    66 AYSKIKVDNHLFNKENMPSHFKVKEYCPLVFRNLRERFGVDDVDYRESLTRSQPI-QIDSSGKSG 129
            .:::...:.......::.:.||.|:|||:|||:||:.|.:|..||..::..::.: :..|.||||
plant   364 QWTRFPPEGSKSTPPHLSAEFKWKDYCPIVFRHLRDLFAIDQADYMLAICGNESLREFASPGKSG 428

  Fly   130 AQFYQSYDKFFIIKSLTSEEIERMHAFLKQYHPYVVERHGKTLLPQYLGMYRI-TVESVQYYFVV 193
            :.||.:.|:.::||::...||:.:...|..|:.: |.::..:|:.::.|::.: .|...:..|:|
plant   429 SAFYLTQDERYMIKTMKKSEIKVLLKMLPNYYEH-VSKYKNSLVTKFFGVHCVKPVGGQKTRFIV 492

  Fly   194 MRNVFSSHLTIHKKFDLKGS----TVDREASEKELEKNLPTFKDNDFIKQKVKLDIGKEAKDKLM 254
            |.|:|.|...|||:||||||    |:|::  |.|:::. .|.||.| :|...:|:      ....
plant   493 MGNLFCSEYRIHKRFDLKGSSHGRTIDKD--EGEIDET-TTLKDLD-LKYVFRLE------TSWF 547

  Fly   255 DTLSNDVDL----LTKLHIMDYSLLVGVHDCVRAEEEALQGDNILTVGRSE-------------- 301
            ....|.:||    |....|||||||:|:|    ..|..::.|..|.:||.:              
plant   548 QAFINQIDLDCEFLEAERIMDYSLLIGLH----FRESGMRDDISLGIGRRDQEDKLMRGYNSLPN 608

  Fly   302 -NSESEECDS-----GERWTYNTPPDSPRGAQYKEVVYEVDIYDIPSIEEKRE-----IYFIAII 355
             :|.::.|:.     ||    :||..:.:.::::|..:|.|..|..:.:..|:     |.:..:|
plant   609 MDSVTQTCNGPLMRLGE----STPAKAEQVSRFEEETWEEDAIDNSNPKGTRKEAVEVILYFGVI 669

  Fly   356 DVLTQYGVKKQAAKAAKTVKYGSNVDGISTCDPEQYAKRFLDFMDK 401
            |:|..|.:.|:...|.|::.  ::...||..||:.|::||.||::|
plant   670 DILQDYDITKKLEHAYKSLH--ADPASISAVDPKLYSRRFRDFINK 713

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 112/409 (27%)
PIP5K3NP_001324179.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23086
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.