DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and pip5k1ca

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_009294612.1 Gene:pip5k1ca / 798876 ZFINID:ZDB-GENE-050208-358 Length:701 Species:Danio rerio


Alignment Length:375 Identity:122/375 - (32%)
Similarity:191/375 - (50%) Gaps:30/375 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GINHTINELSHVNIPVMLLPDDFRAYSKIKVDNHLFNKEN---MPSH----FKVKEYCPLVFRNL 99
            ||.:|:..||......:|:.|.:      .|::..|..|.   .|:|    |:.|.|.|:.||..
Zfish    91 GIGYTVGNLSSKPERDVLMQDFY------VVESIFFPSEGSNLTPAHHFPDFRFKTYAPVAFRYF 149

  Fly   100 RERFGVDDVDYRESLTRSQPIQIDSSGKSGAQFYQSYDKFFIIKSLTSEEIERMHAFLKQYHPYV 164
            ||.||:...||..||.....|::.:.|.||:.||.:.|..||||::..:|.|.:...|..|: ..
Zfish   150 RELFGIRPDDYLYSLCNEPLIELSNPGASGSVFYLTKDDEFIIKTVMHKEAEFLQKLLPGYY-MN 213

  Fly   165 VERHGKTLLPQYLGMYRITVESVQYYFVVMRNVFSSHLTIHKKFDLKGSTVDREASEKELEKNLP 229
            :.::.:||||::.|:|.:.........|||.||....:.:|.|:||||||..|.||:||.||..|
Zfish   214 LNQNPRTLLPKFFGLYCVQSGGKNIRMVVMNNVLPRVVRMHLKYDLKGSTYKRRASKKEREKAKP 278

  Fly   230 TFKDNDFIKQKVK-LDIGKEAKDKLMDTLSNDVDLLTKLHIMDYSLLVGVHDCVR-AEEEALQGD 292
            ||||.||:::... |.:..:..:.|:.||..|..:|....|||||||:|||:..: |:|:.::| 
Zfish   279 TFKDLDFMQELPDGLMLDTDTYNALVKTLQRDCLVLESFKIMDYSLLLGVHNIDQAAKEQQMEG- 342

  Fly   293 NILTVGRSENSESEECDSGERWTYNTPPDSPRGAQYKEVVYEVD--IYDIPSIEEKRE--IYFIA 353
                   |:.:..|:....::..|.|..:|.:||.......:.|  :..||::..:.|  :.:|.
Zfish   343 -------SQGNSDEKRPLAQKALYTTAMESIQGASACGEGIDTDDTMGGIPAVNGRGERLLLYIG 400

  Fly   354 IIDVLTQYGVKKQAAKAAKTVKYGSNVDGISTCDPEQYAKRFLDFMDKAI 403
            |||:|..|.:.|:.....|.:.:..  |.:|...|..||.|||.||...:
Zfish   401 IIDILQSYRLIKKLEHTWKALVHDG--DTVSVHRPSFYADRFLRFMSSTV 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 122/373 (33%)
pip5k1caXP_009294612.1 PIPKc 108..448 CDD:214623 117/356 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.